Recombinant Hypocrea Jecorina HFB2 Protein (16-86 aa), His-tagged
| Cat.No. : | HFB2-2227H |
| Product Overview : | Recombinant Hypocrea Jecorina (Trichoderma reesei) HFB2 Protein (16-86 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Hypocrea Jecorina |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 16-86 aa |
| Description : | Responsible for spore hydrophobicity and protection. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 9.2 kDa |
| AA Sequence : | AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Synonyms | hfb2; Hydrophobin II; |
| UniProt ID | P79073 |
| ◆ Recombinant Proteins | ||
| hfb2-3718H | Recombinant Hypocrea jecorina hfb2 protein, His-tagged | +Inquiry |
| HFB2-2056H | Recombinant Hypocrea Jecorina HFB2 Protein (16-86 aa), His-SUMO-tagged | +Inquiry |
| hfb2-3719H | Recombinant Hypocrea jecorina hfb2 protein, His-B2M-JD-tagged | +Inquiry |
| HFB2-2227H | Recombinant Hypocrea Jecorina HFB2 Protein (16-86 aa), His-tagged | +Inquiry |
| hfb2-5556T | Recombinant Trich hfb2 protein, His-sumostar-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HFB2 Products
Required fields are marked with *
My Review for All HFB2 Products
Required fields are marked with *
