Recombinant Klebsiella Pneumoniae BAMA Protein (24-172 aa), His-B2M-Myc-tagged

Cat.No. : BAMA-2102K
Product Overview : Recombinant Klebsiella Pneumoniae (strain 342) BAMA Protein (24-172 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-B2M tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Klebsiella Pneumoniae
Source : E.coli
Tag : B2M&His&Myc
Protein Length : 24-172 aa
Description : Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 33.3 kDa
AA Sequence : FVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEG
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Synonyms BamA;
UniProt ID B5Y1J4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BAMA Products

Required fields are marked with *

My Review for All BAMA Products

Required fields are marked with *

0
cart-icon
0
compare icon