Recombinant Klebsiella Pneumoniae BAMA Protein (24-172 aa), His-B2M-Myc-tagged
| Cat.No. : | BAMA-2102K |
| Product Overview : | Recombinant Klebsiella Pneumoniae (strain 342) BAMA Protein (24-172 aa) is produced by E. coli expression system. This protein is fused with a 10xHis-B2M tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Klebsiella Pneumoniae |
| Source : | E.coli |
| Tag : | B2M&His&Myc |
| Protein Length : | 24-172 aa |
| Description : | Part of the outer membrane protein assembly complex, which is involved in assembly and insertion of beta-barrel proteins into the outer membrane. Constitutes, with BamD, the core component of the assembly machinery. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 33.3 kDa |
| AA Sequence : | FVVKDIHFEGLQRVAVGAALLSMPVRPGDTVTDDDISNTIRALFATGNFEDVRVLRDGDTLLVQVKERPTIASITFSGNKSVKDDMLKQNLEASGVRVGESLDRTTIADIEKGLEDFYYSVGKYSASVKAVVTPLPRNRVDLKLVFQEG |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Synonyms | BamA; |
| UniProt ID | B5Y1J4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAMA Products
Required fields are marked with *
My Review for All BAMA Products
Required fields are marked with *
