Recombinant Klebsiella pneumoniae KPHS_15150 Protein
| Cat.No. : | KPHS_15150-163K |
| Product Overview : | Recombinant Klebsiella pneumoniae KPHS_15150 Protein was expressed in E.coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Klebsiella pneumoniae |
| Source : | E.coli |
| Description : | putative filamentous hemagglutinin |
| Form : | 50mMTris-HCl, pH 8.0, 200mMNaCl, 4M Urea. |
| Molecular Mass : | ~33 kDa |
| AA Sequence : | LNKGTIKSNGLLSQVATASGITNDGSIAGAYYLMLSSGDYIVNTGSLSGGQLIATANGNITNGDSGTMTGTSGLSLTSGGKIRNEEKASLLSNNQIAATAIGDFLNEGKISAKHTSLTFVGDSFKNTGNINSTGQTTIQSLKQDGSANTGEIYNLGNITGENINLQTNGTLAQSSSGRIEATNAITAHSYWLNQNGYMNAADITTDHGVVNNYGNITAKNISITTYSDITNEGQISSTGDLTLNTKNKGAIYNYSTLSAGGNMTLTATKVVNGGKSCGILGLAKCGVGTLTADKLVLNSSQKYVSDMGGKQYFKSTEVNTVK |
| Purity : | >95% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Gene Name | KPHS_15150 putative filamentous hemagglutinin [ Klebsiella pneumoniae subsp. pneumoniae HS11286 ] |
| Official Symbol | KPHS_15150 |
| Gene ID | 11846516 |
| Protein Refseq | YP_005225815 |
| UniProt ID | A0A0H3GLE2 |
| ◆ Recombinant Proteins | ||
| KPHS_41620-26K | Recombinant Klebsiella pneumoniae KPHS_41620 Protein | +Inquiry |
| KPHS_15150-162K | Recombinant Klebsiella pneumoniae KPHS_15150 Protein | +Inquiry |
| KPHS_15150-163K | Recombinant Klebsiella pneumoniae KPHS_15150 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPHS_15150 Products
Required fields are marked with *
My Review for All KPHS_15150 Products
Required fields are marked with *



