Recombinant Klebsiella pneumoniae KPHS_36570 Protein

• Cat.No.: KPHS_36570-27K
• Product Overview: Recombinant Klebsiella pneumoniae KPHS_36570 Protein was expressed in E. coli.

Specification

• Species: Klebsiella pneumoniae
• Source: E.coli
• Description: Ferric iron-catecholate outer membrane transporter.
• Form: Liquid. In 100 mM Tris-HCl containing 100 mM NaH2PO4 and 4 M Urea (pH8.0).
• Molecular Mass: ~18 kDa
• AA Sequence: DVNEETLVVTASATEQNVKDAPASISVITQQDLQRKPVQNLKDVLRDVPGVQLTNEGDNRKGVSIRGLSSSYTLILVDGKRVNSRNAVFRHNDFDLNWIPVDAIERIEVVRGPMSSLYGSDALGGVVN
• Purity: >90%
• Storage: Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles.
• Concentration: 0.6 mg/ml
• Official Full Name: ferric iron-catecholate outer membrane transporter

Gene Information

• Gene Name: KPHS_36570 ferric iron-catecholate outer membrane transporter [ Klebsiella pneumoniae subsp. pneumoniae HS11286 ]
• Official Symbol: KPHS_36570
• Gene ID: 11848688
• Protein Refseq: YP_005227957
• UniProt ID: A6TBP0