Recombinant Klebsiella pneumoniae KPHS_39610 Protein
| Cat.No. : | KPHS_39610-165K |
| Product Overview : | Recombinant Klebsiella pneumoniae KPHS_39610 Protein was expressed in E.coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Klebsiella pneumoniae |
| Source : | E.coli |
| Description : | DNA repair protein RecO |
| Form : | 50mMTris-HCl, pH 8.0, 200mMNaCl, 4M Urea. |
| Molecular Mass : | ～27 kDa |
| AA Sequence : | MDGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSNLKGALQPFTPLLVRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYVNELISRVLEHETRFSELFFDYLHCIQALAGASGSPEPALRRFELALLGHLGYGVDFLHCAGSGEPVDDTMTYRYREEKGFIASLVIDNNTFTGHHLKALASREFPDVDTLRAAKRFTRIALKPYLGGKPLKSRELFRQFMPARKARADNTNND |
| Purity : | >90% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Gene Name | KPHS_39610 DNA repair protein RecO [ Klebsiella pneumoniae subsp. pneumoniae HS11286 ] |
| Official Symbol | KPHS_39610 |
| Gene ID | 11849000 |
| Protein Refseq | YP_005228261 |
| UniProt ID | A6TCH9 |
| ◆ Recombinant Proteins | ||
| KPHS_39610-165K | Recombinant Klebsiella pneumoniae KPHS_39610 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KPHS_39610 Products
Required fields are marked with *
My Review for All KPHS_39610 Products
Required fields are marked with *
Recently Viewed
