Recombinant Klebsiella pneumoniae (strain 342) arnT protein, His-tagged
Cat.No. : | arnT-01K |
Product Overview : | Recombinant Klebsiella pneumoniae (strain 342) arnT protein(B5XTL1)(429-551aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Klebsiella Pneumoniae |
Source : | E.coli |
Tag : | His |
Protein Length : | 429-551aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.8 kDa |
AA Sequence : | RVIDSKQPQFLVDIVSESLQPSRYVLTNNVGIAGGLAWELKRSDIIMFDKQGELKYGLDWPDAQGSFVSQAGFADWLATHRQQGPVSLVLLMDKGESMVDLPLPKPDNAYELGRVVFLQYLPQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
◆ Recombinant Proteins | ||
ARNT-450R | Recombinant Rat ARNT Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL-1217HF | Recombinant Full Length Human Aryl Hydrocarbon Receptor Nuclear Translocator(Arnt) Protein, His-Tagged | +Inquiry |
Arnt-3647M | Recombinant Mouse Arnt, His-tagged | +Inquiry |
arnT-01K | Recombinant Klebsiella pneumoniae (strain 342) arnT protein, His-tagged | +Inquiry |
ARNT-1433HFL | Recombinant Full Length Human ARNT, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARNT-8692HCL | Recombinant Human ARNT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All arnT Products
Required fields are marked with *
My Review for All arnT Products
Required fields are marked with *
0
Inquiry Basket