Recombinant LCMV GPC Protein, His tagged
| Cat.No. : | GPC-01L |
- Specification
- Gene Information
- Related Products
- Download
| Species : | LCMV |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 266-498 aa |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Molecular Mass : | 33.3 kDa |
| AA Sequence : | GTFTWTLSDSSGVENPGGYCLTKWMILAAELKCFGNTAVAKCNVNHDAEFCDMLRLIDYNKAALSKFKEDVESALHLFKTTVNSLISDQLLMRNHLRDLMGVPYCNYSKFWYLEHAKTGETSVPKCWLVTNGSYLNETHFSDQIEQEADNMITEMLRKDYIKRQGSTPLALMDLLMFSTSAYLVSIFLHLVKIPTHRHIKGGSCPKPHRLTNKGICSCGAFKVPGVKTVWKRR |
| Purity : | >90% by SDS-PAGE |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPC Products
Required fields are marked with *
My Review for All GPC Products
Required fields are marked with *
