Recombinant Leech Hirudin therapeutic protein(Lepirudin)
| Cat.No. : | Hirudin-P030L |
| Product Overview : | Lepirudin is identical to natural hirudin except for substitution of leucine for isoleucine at the N-terminal end of the molecule and the absence of a sulfate group on the tyrosine at position 63. It is produced via yeast cells. |
| Availability | August 19, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Leech |
| Source : | Yeast |
| Tag : | Non |
| Protein Length : | 65 Aa |
| Description : | The expression product is the active ingredient of Refludan. |
| Molecular Mass : | 6963.4 Da |
| AA Sequence : | LVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ |
| Endotoxin : | < 1.0 EU per μg of the protein |
| Purity : | >95% |
| Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
| Alias : | Hirudin; Lepirudin |
| Publications : |
| ◆ Recombinant Proteins | ||
| Hirudin-4247M | Recombinant Medicinal leech Hirudin protein, GST-tagged | +Inquiry |
| HIRUD-1239P | Active Recombinant Poecilobdella viridis Hirudin Protein | +Inquiry |
| Hirudin-02 | Recombinant Hirudo Hirudin protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hirudin Products
Required fields are marked with *
My Review for All Hirudin Products
Required fields are marked with *



