Recombinant Leishmania Donovani LDBPK361420 Protein (15-98 aa), His-tagged

• Cat.No.: LDBPK361420-2483L
• Product Overview: Recombinant Leishmania Donovani (strain BPK282A1) LDBPK361420 Protein (15-98 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Leishmania Donovani
• Source: E.coli
• Tag: His
• Protein Length: 15-98 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 13.7 kDa
• AA Sequence: NKLIVEEPYNDDNSVVSLNPKRMEELNIFRGDTVLVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIAPCKD
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: LDBPK_361420 Transitional endoplasmic reticulum ATPase, putative [ Leishmania donovani ]
• Official Symbol: LDBPK361420
• Synonyms: LDBPK_361420
• Gene ID: 13388143
• mRNA Refseq: XM_003865210
• Protein Refseq: XP_003865258
• UniProt ID: E9BTK1