Recombinant Leishmania Donovani LDBPK361420 Protein (15-98 aa), His-tagged

Cat.No. : LDBPK361420-2483L
Product Overview : Recombinant Leishmania Donovani (strain BPK282A1) LDBPK361420 Protein (15-98 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Leishmania Donovani
Source : E.coli
Tag : His
Protein Length : 15-98 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 13.7 kDa
AA Sequence : NKLIVEEPYNDDNSVVSLNPKRMEELNIFRGDTVLVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIAPCKD
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name LDBPK_361420 Transitional endoplasmic reticulum ATPase, putative [ Leishmania donovani ]
Official Symbol LDBPK361420
Synonyms LDBPK_361420;
Gene ID 13388143
mRNA Refseq XM_003865210
Protein Refseq XP_003865258
UniProt ID E9BTK1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LDBPK361420 Products

Required fields are marked with *

My Review for All LDBPK361420 Products

Required fields are marked with *

0
cart-icon