Recombinant Leishmania Donovani LDBPK361420 Protein (15-98 aa), His-tagged
Cat.No. : | LDBPK361420-2483L |
Product Overview : | Recombinant Leishmania Donovani (strain BPK282A1) LDBPK361420 Protein (15-98 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Leishmania Donovani |
Source : | E.coli |
Tag : | His |
Protein Length : | 15-98 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 13.7 kDa |
AA Sequence : | NKLIVEEPYNDDNSVVSLNPKRMEELNIFRGDTVLVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIAPCKD |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | LDBPK_361420 Transitional endoplasmic reticulum ATPase, putative [ Leishmania donovani ] |
Official Symbol | LDBPK361420 |
Synonyms | LDBPK_361420; |
Gene ID | 13388143 |
mRNA Refseq | XM_003865210 |
Protein Refseq | XP_003865258 |
UniProt ID | E9BTK1 |
◆ Recombinant Proteins | ||
LDBPK361420-2483L | Recombinant Leishmania Donovani LDBPK361420 Protein (15-98 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDBPK361420 Products
Required fields are marked with *
My Review for All LDBPK361420 Products
Required fields are marked with *