Recombinant M. tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85C Protein, His-tagged
Cat.No. : | fbpC-1208M |
Product Overview : | Recombinant Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) Diacylglycerol acyltransferase/mycolyltransferase Ag85C protein (46-340aa) was expressed in E. coli with N-terminal his tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | M.tuberculosis |
Source : | E.coli |
Tag : | His |
Protein Length : | 46-340 a.a. |
Description : | The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria to fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM (By similarity). |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 36.1 kDa |
AA Sequence : | AFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Diacylglycerol acyltransferase/mycolyltransferase Ag85C |
Official Symbol | Diacylglycerol acyltransferase/mycolyltransferase Ag85C |
Synonyms | Diacylglycerol acyltransferase/mycolyltransferase Ag85C; EC 2.3.1.122; EC 2.3.1.20; DGAT; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex C; 85C; Ag85C; Fibronectin-binding protein C; Fbps C |
UniProt ID | P9WQN8 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Diacylglycerol acyltransferase/mycolyltransferase Ag85C Products
Required fields are marked with *
My Review for All Diacylglycerol acyltransferase/mycolyltransferase Ag85C Products
Required fields are marked with *