Recombinant M. tuberculosis ESAT-6-like protein EsxH Protein, His-SUMO-tagged
Cat.No. : | esxH-1204M |
Product Overview : | Recombinant Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) ESAT-6-like protein EsxH Protein (2-96aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | M.tuberculosis |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-96 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 26.3 kDa |
AA Sequence : | SQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHA MSSTHEANTMAMMARDTAEAAKWGG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | ESAT-6-like protein EsxH |
Official Symbol | ESAT-6-like protein EsxH |
Synonyms | ESAT-6-like protein EsxH; esxH; 10 kDa antigen CFP7; CFP-7;Low molecular weight protein antigen 7; Protein TB10.4; CFP7 |
UniProt ID | P9WNK2 |
◆ Recombinant Proteins | ||
esxH-1204M | Recombinant M. tuberculosis ESAT-6-like protein EsxH Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESAT-6-like protein EsxH Products
Required fields are marked with *
My Review for All ESAT-6-like protein EsxH Products
Required fields are marked with *