Recombinant M. tuberculosis Immunogenic protein MPT64 Protein, His-tagged
Cat.No. : | mpt64-1286M |
Product Overview : | Recombinant Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) Immunogenic protein MPT64 Protein (24-228aa) was expressed in Yeast with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | M.tuberculosis |
Source : | Yeast |
Tag : | His |
Protein Length : | 24-228 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 24.4 kDa |
AA Sequence : | APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYEL NITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQ GELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Immunogenic protein MPT64 |
Official Symbol | Immunogenic protein MPT64 |
Synonyms | Immunogenic protein MPT64; mpt64; Antigen MPT64 |
UniProt ID | P9WIN8 |
◆ Recombinant Proteins | ||
mpt64-1286M | Recombinant M. tuberculosis Immunogenic protein MPT64 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Immunogenic protein MPT64 Products
Required fields are marked with *
My Review for All Immunogenic protein MPT64 Products
Required fields are marked with *