Recombinant Maize ABP1 Protein (39-201 aa), His-tagged
Cat.No. : | ABP1-1265M |
Product Overview : | Recombinant Maize ABP1 Protein (39-201 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Maize |
Source : | E.coli |
Tag : | His |
Protein Length : | 39-201 aa |
Description : | This is probably a receptor for the plant hormone auxin. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 22.4 kDa |
AA Sequence : | SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALNHGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKGKGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDPHQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPHTAAVLKFPFVWDEDCFEAAKDEL |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Synonyms | ABP1; ERABP1; |
UniProt ID | P13689 |
◆ Recombinant Proteins | ||
ABP1-16H | Recombinant Human ABP1 Protein, His-tagged | +Inquiry |
ABP1-9255H | Recombinant Human ABP1, GST-tagged | +Inquiry |
Abp1-3410R | Recombinant Rat Abp1, His-tagged | +Inquiry |
ABP1-832HF | Recombinant Full Length Human ABP1 Protein, GST-tagged | +Inquiry |
ABP1-3409H | Recombinant Human ABP1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABP1-9123HCL | Recombinant Human ABP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABP1 Products
Required fields are marked with *
My Review for All ABP1 Products
Required fields are marked with *