Recombinant Malus Domestica (Apple) Mal d 2 protein, His-tagged
| Cat.No. : | Mald2-01H |
| Product Overview : | Recombinant Malus Domestica (Apple) Mal d 2 protein with N-terminal His6 fusion tag was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Malus Domestica |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 243 |
| Description : | Chain A, THAUMATIN-LIKE PROTEIN |
| Form : | Buffered aqueous solution |
| Molecular Mass : | 25.5 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAKITFTNNCPNTVWPGTLTGDQKPQLSLTGFELASKASRSVDAPSPWSGRFWGRTRCSTDAAGKFTCETADCGSGQVACNGAGAVPPATLVEITIAANGGQDYYDVSLVDGFNLPMSVAPQGGTGECKPSSCPANVNKVCPAPLQVKAADGSVISCKSACLAFGDSKYCCTPPNNTPETCPPTEYSEIFEKQCPQAYSYAYDDKNSTFTCSGGPDYVITFCP |
| Purity : | >90% by SDS-PAGE |
| Applications : | Antigen for antibody production ELISA |
| Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.654 mg/ml |
| Storage Buffer : | Solution in 50mM Tris, 0.3 M NaCl, pH7.5. |
| Gene Name | Mal d2 |
| Official Symbol | Mal d2 |
| Synonyms | Major allergen Mal d 2, Ypr10 protein, MALD2, ypr10 |
| Gene ID | 103425641 |
| mRNA Refseq | Z72427.1 |
| Protein Refseq | 3ZS3_A |
| ◆ Recombinant Proteins | ||
| Mald2-01H | Recombinant Malus Domestica (Apple) Mal d 2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mald2 Products
Required fields are marked with *
My Review for All Mald2 Products
Required fields are marked with *
Recently Viewed
