Recombinant MBP Protein
| Cat.No. : | MBP-01 |
| Product Overview : | Recombinant MBP Protein without tag was expressed in E. coli. |
| Availability | November 28, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Tag : | Non |
| AA Sequence : | MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQT |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Short Term Storage at +4 centigrade. Long Term Storage at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 2.2 mg/mL |
| Storage Buffer : | 50mM Tris-HCl, 150mM NaCl, pH 8.0 |
| Official Symbol | MBP |
| Synonyms | MBP |
| ◆ Recombinant Proteins | ||
| MBP-30122H | Recombinant Human MBP protein, GST-tagged | +Inquiry |
| MBP-66E | Recombinant E. coli MBP Protein | +Inquiry |
| MBP-286H | Recombinant Human MBP | +Inquiry |
| MBP-4513H | Recombinant Human MBP Protein (Met1-Lys192), N-His tagged | +Inquiry |
| Mbp-644M | Recombinant Mouse Mbp protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| MBP-89S | Native Swine MBP Protein | +Inquiry |
| MBP-99S | Native Swine MBP | +Inquiry |
| MBP-6949M | Native Mouse Myelin basic protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MBP-4438HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
| MBP-4437HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
| MBP-4436HCL | Recombinant Human MBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBP Products
Required fields are marked with *
My Review for All MBP Products
Required fields are marked with *
