Recombinant MBP Protein
| Cat.No. : | MBP-01 |
| Product Overview : | Recombinant MBP Protein without tag was expressed in E. coli. |
| Availability | August 12, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Tag : | Non |
| AA Sequence : | MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQT |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Short Term Storage at +4 centigrade. Long Term Storage at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 2.2 mg/mL |
| Storage Buffer : | 50mM Tris-HCl, 150mM NaCl, pH 8.0 |
| Official Symbol | MBP |
| Synonyms | MBP |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MBP Products
Required fields are marked with *
My Review for All MBP Products
Required fields are marked with *



