Recombinant Medicago tribuloides MTR protein(29-81aa), His&Myc-tagged
| Cat.No. : | MTR-8654M |
| Product Overview : | Recombinant Medicago tribuloides MTR protein(G7JRT4)(29-81aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Medicago tribuloides |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 29-81aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 13.3 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | FPICSTIHGVQVGETCFSIIQKFAIEQPLFLRLNPNINCSGIFVGQWVCVNGR |
| ◆ Recombinant Proteins | ||
| MTR-8654M | Recombinant Medicago tribuloides MTR protein(29-81aa), His&Myc-tagged | +Inquiry |
| MTR-9794Z | Recombinant Zebrafish MTR | +Inquiry |
| MTR-3817R | Recombinant Rat MTR Protein | +Inquiry |
| MTR-1704H | Recombinant Human MTR Protein (923-1265 aa), His-tagged | +Inquiry |
| MTR-301155H | Recombinant Human MTR protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MTR Products
Required fields are marked with *
My Review for All MTR Products
Required fields are marked with *




