Recombinant Methanothermobacter Marburgensis FNO Protein (1-224 aa), His-Myc-tagged
Cat.No. : | FNO-2486M |
Product Overview : | Recombinant Methanothermobacter Marburgensis (strain ATCC BAA-927/DSM 2133/JCM 14651/NBRC 100331/OCM 82/Marburg) (Methanobacterium thermoautotrophicum) FNO Protein (1-224 aa) is produced by E. coli expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Methanothermobacter Marburgensis |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-224 aa |
Description : | Catalyzes the reduction of NADP+ with F420H2 via hydride transfer, and the reverse reaction, i.e. the reduction of F420 with NADPH. Probably functions in the regeneration of NADPH required in biosynthetic reactions. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 28.4 kDa |
AA Sequence : | MKIAVLGGTGDQGLGLALRLALAGEEVIIGSRDAEKAVSAAQKVLEIAERDDLKVKGATNAEAAEEAEVAILTVPLQAQMATLGSVKEAIKGKVLIDATVPIDSCLGGSAVRYIDLWDGSAAERAARFLEDQGTRVAAAFNNISASALLDITGPVDCDCLIASDHRDALDLASELAEKIDGVRAIDCGGLENARVIEKITPLLINLNIKNRIRNAGIRITNLPE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Synonyms | fno; |
UniProt ID | D9PVP5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FNO Products
Required fields are marked with *
My Review for All FNO Products
Required fields are marked with *