Recombinant Monkeypox virus A29L Protein, His-tagged

Cat.No. : A29L-241M
Product Overview : Recombinant Monkeypox virus A29L Protein with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : MPX
Source : E.coli
Tag : His
Description : Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.
Molecular Mass : ~12 kDa
AA Sequence : HMDGTLFPGDDDLAIPATEFFSTKAAKNPETKREAIVKAYGDDNEETLKQRLTNLEKKITNITTKFEQIEKCCKHNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYELE
Purity : Transferred into competent cells and the supernatant was purified by affinity chromatography and the purity is > 95% (by SDS-PAGE).
Notes : For research use only, not for use in diagnostic procedure.
Storage : Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
Storage Buffer : PBS, 4M Urea, pH7.4
Official Symbol A29L
Synonyms A29L
UniProt ID Q9YN60

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All A29L Products

Required fields are marked with *

My Review for All A29L Products

Required fields are marked with *

0
cart-icon
0
compare icon