Recombinant Monkeypox Virus I7L Protein, His tagged
| Cat.No. : | MPXV-0586 |
| Product Overview : | Recombinant Monkeypox Virus I7L Protein with His-tag was expressed in E. coli. |
| Availability | June 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | MPX |
| Source : | E.coli |
| Tag : | His |
| Molecular Mass : | The protein has a calculated MW of 50 kDa. |
| AA Sequence : | MERYTDLVISKIPELGFTNLLCHIYSLAGLCSNIDVSKFLTNCNGYVVEKYDKSTTAGKVSCIPIGMMLELVESGHLSRPNSSDELDQKKELTDELTTRYHSIYDVFELPTSIPLAYFFKPQLREKVSKAIDFSQMDLKIDDLSRKGIHTGENPKVVKMKIEPERGAWMSNRSIKNLVSQFAYGSEVDYIGQFDMRFLNSLAIHEKFDAFMNKHILSYILKDKIKSSTSRFVMFGFCYLSHWKCVIYDKKQCLVSFYDSGGNIPTEFHHYNNFYFYSFSDGFNTNHRHSVLDNTNCDIDVLFRFFECTFGAKIGCINVEVNQLLESECGMFISLFMILCTRTPPKSFKSLKKVYTFFKFLADKKMTLFKSILFNLQDLSLYITETDNAGLKEYKRMEKWTKKSINVICDKLTTKLNRIVDDDEHHHHHH |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.34 mg/mL |
| Storage Buffer : | 25mM Tris, pH 6.8, 150mM NaCl, 0.1% SKL |
| Gene Name | OPG083 Viral core cysteine proteinase [ Monkeypox virus ] |
| Official Symbol | OPG083 |
| Synonyms | OPG083; Viral core cysteine proteinase; Taxonomic breadth: chordopoxvirinae; Old product: I7L; virion core protein; similar to DNA topoisomerase II; Virion core cysteine protease; similar to VACV-WR I7L and VACV-Cop I7L |
| Gene ID | 929056 |
| Protein Refseq | NP_536495 |
| UniProt ID | A0A0F6N6K4 |
| ◆ Recombinant Proteins | ||
| MPXV-0586 | Recombinant Monkeypox Virus I7L Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OPG083 Products
Required fields are marked with *
My Review for All OPG083 Products
Required fields are marked with *
