Recombinant Moraxella catarrhalis MCR_1594 Protein
| Cat.No. : | MCR_1594-38M |
| Product Overview : | Recombinant Moraxella catarrhalis MCR_1594 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Moraxella catarrhalis |
| Source : | E.coli |
| Description : | Cytochrome c class I |
| Form : | Liquid. In 50 mM NaH2PO4 buffer (pH8.0) containing 300 mM NaCl. |
| Molecular Mass : | ~18 kDa |
| AA Sequence : | SDNSTSTPAPVNETQPSTPTSEPAPAQPEPSVETQATPETAETQDAPEVAEVTEPVDVTTSHAPVEAASIEVGKARYEKTCKVCHDAGLLEAPKITDKAEWQKRLDEKGLETLQAHSAKGFNKMPAQAIGDVAESEVYAAVNYILEQAK |
| Purity : | >85% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.5 mg/ml |
| Official Symbol | MCR_1594 |
| UniProt ID | D5V8G2 |
| ◆ Recombinant Proteins | ||
| MCR_1594-38M | Recombinant Moraxella catarrhalis MCR_1594 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MCR_1594 Products
Required fields are marked with *
My Review for All MCR_1594 Products
Required fields are marked with *



