Recombinant Moraxella catarrhalis msp22 Protein
| Cat.No. : | msp22-95M |
| Product Overview : | Recombinant Moraxella catarrhalis msp22 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Moraxella catarrhalis |
| Source : | E.coli |
| Description : | Cytochrome c class II Msp22 |
| Form : | Liquid. In 100 mM NaH2PO4 100mM Tris 4 M Urea pH 8.0. |
| Molecular Mass : | ~16.7kDa |
| AA Sequence : | NSSGTATANNPQVEDRAKLMKDWRHANEGMKAMIEDPSRFDAITFKERADFIADTNATMWVHFEGEMAQGGHAKDEIWTDPEGFQTKIEAFTSSINALALAASEAASAADVEASYGEMASQCGSCHKAYKKK |
| Purity : | >85% |
| Storage : | Short Term Storage at 4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20 to -80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 1.6 mg/ml |
| Official Symbol | msp22 |
| UniProt ID | D5VDC1 |
| ◆ Recombinant Proteins | ||
| msp22-95M | Recombinant Moraxella catarrhalis msp22 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All msp22 Products
Required fields are marked with *
My Review for All msp22 Products
Required fields are marked with *



