Recombinant Mouse ABHD11 Protein (1-307 aa), His-tagged

• Cat.No.: ABHD11-1747M
• Product Overview: Recombinant Mouse ABHD11 Protein (1-307 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 1-307 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 35.6 kDa
• AA Sequence: MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSGPTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQDFMDAVTSFLA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: Abhd11 abhydrolase domain containing 11 [ Mus musculus ]
• Official Symbol: ABHD11
• Synonyms: ABHD11; abhydrolase domain containing 11; Wbscr21; 1110054D16Rik; A630008N09Rik
• Gene ID: 68758
• mRNA Refseq: NM_001190437
• Protein Refseq: NP_001177366
• UniProt ID: Q8K4F5