Recombinant Mouse ABHD11 Protein (1-307 aa), His-SUMO-tagged
| Cat.No. : | ABHD11-1062M |
| Product Overview : | Recombinant Mouse ABHD11 Protein (1-307 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-307 aa |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 49.6 kDa |
| AA Sequence : | MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSGPTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQDFMDAVTSFLA |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | Abhd11 abhydrolase domain containing 11 [ Mus musculus ] |
| Official Symbol | ABHD11 |
| Synonyms | ABHD11; Wbscr21; 1110054D16Rik; A630008N09Rik; |
| Gene ID | 68758 |
| mRNA Refseq | NM_001190437 |
| Protein Refseq | NP_001177366 |
| UniProt ID | Q8K4F5 |
| ◆ Recombinant Proteins | ||
| ABHD11-1747M | Recombinant Mouse ABHD11 Protein (1-307 aa), His-tagged | +Inquiry |
| ABHD11-1236Z | Recombinant Zebrafish ABHD11 | +Inquiry |
| ABHD11-1062M | Recombinant Mouse ABHD11 Protein (1-307 aa), His-SUMO-tagged | +Inquiry |
| Abhd11-1466M | Recombinant Mouse Abhd11 Protein, Myc/DDK-tagged | +Inquiry |
| ABHD11-826HF | Recombinant Full Length Human ABHD11 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABHD11-9140HCL | Recombinant Human ABHD11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD11 Products
Required fields are marked with *
My Review for All ABHD11 Products
Required fields are marked with *
