Recombinant Mouse ABHD11 Protein (1-307 aa), His-SUMO-tagged
Cat.No. : | ABHD11-1062M |
Product Overview : | Recombinant Mouse ABHD11 Protein (1-307 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-307 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 49.6 kDa |
AA Sequence : | MLRWARAWRVPRGVLGASSPRRLAVPVTFCSSRSSGQENADLRPLPLSYNLLDGDATLPAIVFLHGLFGSKTNFNSLAKAMVQRTGRRVLTVDARNHGDSPHSPDASYEAMSQDLQGLLPQLGLVPCVLVGHSMGGKTAMLLALQRPDVVERLVVVDISPVGTTPGSHIGAFIAAMKAVEIPEKVPHSQARKLADKQLSSVVKEAGIRQFLLTNLVEVGGRFSWRLNLDTLAQHLDKIMTFPQQREPYSGPTLFLLGGNSTYVQPSHHSEIRRLFPQAQIQTVPNAGHWVHSDKPQDFMDAVTSFLA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | Abhd11 abhydrolase domain containing 11 [ Mus musculus ] |
Official Symbol | ABHD11 |
Synonyms | ABHD11; Wbscr21; 1110054D16Rik; A630008N09Rik; |
Gene ID | 68758 |
mRNA Refseq | NM_001190437 |
Protein Refseq | NP_001177366 |
UniProt ID | Q8K4F5 |
◆ Recombinant Proteins | ||
ABHD11-6321H | Recombinant Human ABHD11 protein, His-tagged | +Inquiry |
ABHD11-072H | Recombinant Human ABHD11 Protein, GST-Tagged | +Inquiry |
Abhd11-1466M | Recombinant Mouse Abhd11 Protein, Myc/DDK-tagged | +Inquiry |
ABHD11-1747M | Recombinant Mouse ABHD11 Protein (1-307 aa), His-tagged | +Inquiry |
ABHD11-826HF | Recombinant Full Length Human ABHD11 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD11-9140HCL | Recombinant Human ABHD11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD11 Products
Required fields are marked with *
My Review for All ABHD11 Products
Required fields are marked with *