Recombinant Mouse Acy1 Protein, His-tagged
Cat.No. : | Acy1-7144M |
Product Overview : | Recombinant mouse Acy1, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-408 |
Description : | Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate). |
Form : | Liquid |
Molecular Mass : | 48.4 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSEFMTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASVPTLPGES |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.25 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | In Phosphate buffered saline (pH7.4) containing 10 % glycerol. |
Gene Name | Acy1 aminoacylase 1 [ Mus musculus (house mouse) ] |
Official Symbol | Acy1 |
Synonyms | Acy1; aminoacylase 1; Acy-; Acy-1; 1110014J22Rik; aminoacylase-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 |
Gene ID | 109652 |
mRNA Refseq | NM_001276442 |
Protein Refseq | NP_001263371 |
UniProt ID | Q99JW2 |
◆ Recombinant Proteins | ||
ACY1-1152H | Recombinant Human ACY1 Protein, DDK-tagged | +Inquiry |
ACY1-4770H | Recombinant Human ACY1 protein, GST-tagged | +Inquiry |
ACY1-262H | Recombinant Human ACY1 Protein, GST-tagged | +Inquiry |
Acy1-299M | Recombinant Mouse Acy1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACY1-27H | Recombinant Human Aminoacylase 1, T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACY1-3095MCL | Recombinant Mouse ACY1 cell lysate | +Inquiry |
ACY1-725HCL | Recombinant Human ACY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Acy1 Products
Required fields are marked with *
My Review for All Acy1 Products
Required fields are marked with *
0
Inquiry Basket