Recombinant Mouse Acy1 Protein, His-tagged
| Cat.No. : | Acy1-7144M |
| Product Overview : | Recombinant mouse Acy1, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-408 |
| Description : | Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate). |
| Form : | Liquid |
| Molecular Mass : | 48.4 kDa |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSEFMTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASVPTLPGES |
| Purity : | > 90 % by SDS-PAGE |
| Stability : | Shelf life: one year from despatch. |
| Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
| Concentration : | 0.25 mg/mL (determined by absorbance at 280nm) |
| Storage Buffer : | In Phosphate buffered saline (pH7.4) containing 10 % glycerol. |
| Gene Name | Acy1 aminoacylase 1 [ Mus musculus (house mouse) ] |
| Official Symbol | Acy1 |
| Synonyms | Acy1; aminoacylase 1; Acy-; Acy-1; 1110014J22Rik; aminoacylase-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 |
| Gene ID | 109652 |
| mRNA Refseq | NM_001276442 |
| Protein Refseq | NP_001263371 |
| UniProt ID | Q99JW2 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Acy1 Products
Required fields are marked with *
My Review for All Acy1 Products
Required fields are marked with *


