Recombinant Mouse Acy1 Protein, His-tagged

Cat.No. : Acy1-7144M
Product Overview : Recombinant mouse Acy1, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 1-408
Description : Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate).
Form : Liquid
Molecular Mass : 48.4 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSEFMTTKDPESEHPSVTLFRQYLRICTVQPNPDYGGAITFLEERARQLGLSCQKIEVVPGFVITVLTWPGTNPSLPSILLNSHTDVVPVFKEHWHHDPFEAFKDSEGYIYARGSQDMKSVSIQYLEAVRRLKSEGHRFPRTIHMTFVPDEEVGGHKGMELFVKRPEFQALRAGFALDEGLANPTDAFTVFYSERSPWWVRVTSTGKPGHASRFIEDTAAEKLHKVISSILAFREKERQRLQANPHLKEGAVTSVNLTKLEGGVAYNVVPATMSASFDFRVAPDVDMKAFEKQLQRWCQEAGEGVTFEFAQKFTEPRMTPTDDSDPWWAAFSGACKAMNLTLEPEIFPAATDSRYIRAVGIPALGFSPMNRTPVLLHDHNERLHEDIFLRGVDIYTGLLSALASVPTLPGES
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.25 mg/mL (determined by absorbance at 280nm)
Storage Buffer : In Phosphate buffered saline (pH7.4) containing 10 % glycerol.
Gene Name Acy1 aminoacylase 1 [ Mus musculus (house mouse) ]
Official Symbol Acy1
Synonyms Acy1; aminoacylase 1; Acy-; Acy-1; 1110014J22Rik; aminoacylase-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14
Gene ID 109652
mRNA Refseq NM_001276442
Protein Refseq NP_001263371
UniProt ID Q99JW2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Acy1 Products

Required fields are marked with *

My Review for All Acy1 Products

Required fields are marked with *

0
cart-icon
0
compare icon