Recombinant Mouse Adamts13 protein, hFc-tagged
| Cat.No. : | Adamts13-2322M |
| Product Overview : | Recombinant Mouse Adamts13 protein(Q769J6)(904-1137aa), fused with C-terminal hFc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 904-1137aa |
| Tag : | C-hFc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 54.2 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA |
| Gene Name | Adamts13 a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 13 [ Mus musculus ] |
| Official Symbol | Adamts13 |
| Synonyms | ADAMTS13; a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 13; A disintegrin and metalloproteinase with thrombospondin motifs 13; ADAM-TS13; ADAMTS-13; ADAM-TS 13; vWF-cleaving protease; ADAMTS13 isoform IAP-b; von Willebrand factor-cleaving protease; vWF-CP mRNA for von Willebrand factor-cleaving; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 13; Gm710; vWF-CP; |
| Gene ID | 279028 |
| mRNA Refseq | NM_001001322 |
| Protein Refseq | NP_001001322 |
| ◆ Recombinant Proteins | ||
| ADAMTS13-5660H | Recombinant Human ADAMTS13 protein, His & T7-tagged | +Inquiry |
| ADAMTS13-299H | Recombinant Human ADAMTS13 Protein, GST-tagged | +Inquiry |
| ADAMTS13-820H | Active Recombinant Human ADAMTS13 protein, His-tagged | +Inquiry |
| ADAMTS13-2184M | Recombinant Mouse ADAMTS13 protein(904-1137aa), His-tagged | +Inquiry |
| ADAMTS13-137H | Recombinant Human ADAMTS13, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Adamts13 Products
Required fields are marked with *
My Review for All Adamts13 Products
Required fields are marked with *
