Recombinant Mouse Adiponectin, C1Q And Collagen Domain Containing

• Cat.No.: Adipoq-5373M
• Product Overview: Recombinant MouseAdipoq (aa 111-247) is the globular domain of Mouse Adipoq, containing 138amino acid residues from aa 111-247.

Specification

• Cat. No.: Adipoq-5373M
• Description: Thereare four distinct regions of Adipoq. The first is ashort signal sequence that targets the hormone for secretion outside thecell; next is a short region that varies between species; the third is a65-amino acid region with similarity to collagenous proteins; the last is aglobular domain. Overall this gene shows similarity to the complement 1Qfactors. However, when the 3-dimensional structure of the globular region wasdetermined, a striking similarity to TNFα was observed, despite unrelatedprotein sequences.
• Source: E. coli
• Species: Mouse
• Form: Liquid in 20 mMTris-HCl, pH 7.5 + 50 mM NaCl + 5 mM DTT + 10% glycerol.
• Purity: > 95.0% asdetermined by RP-HPLC and SDS-PAGE analyses.
• Endotoxin Level: < 0.1 ng/μg ofAdipoQ.
• Amino Acid Sequence: MAYMYRSAFSVGLETRVTVP NVPIRFTKIF YNQQNHYDGS TGKFYCNIPG LYYFSYHITVYMKDVKVSLFKKDKAVLFTY DQYQEKNVDQ ASGSVLLHLE VGDQVWLQVYGDGDHNGLYADNVNDSTFTG FLLYHDTN
• Molecular Weight: 16 kDa
• Concentration: 1 mg/ml
• Storage: Store at -20°C to-80°C. Avoidrepeated freeze-thaw cycles.
• OfficialSymbol: Adipoq

Gene Information

• Gene Name: Adipoq adiponectin, C1Q andcollagen domain containing [ Mus musculus ]
• Synonyms: Adipoq; adiponectin,C1Q and collagen domain containing; APN; Acdc; apM1; 30kDa; GBP28; adipo;Acrp30; adiponectin; OTTMUSP00000050447; adipocyte-specific protein AdipoQ;adipocyte complement related protein; 30 kDa adipocyte complement-relatedprotein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q andcollagen domain containing; adipocyte, C1q and collagen domain-containingprotein
• Gene ID: 11450
• mRNA Refseq: NM_009605
• Protein Refseq: NP_033735
• Chromosome Location: 16 B3-B4;16 16.0 cM
• Pathway: Adipocytokinesignaling pathway; Adipogenesis; Leptin and adiponectin; PPAR signalingpathway; Type II diabetes mellitus
• Function: eukaryotic cellsurface binding; hormone activity; protein binding; protein homodimerizationactivity; receptor binding; sialic acid binding