Recombinant Mouse Adiponectin, C1Q And Collagen Domain Containing
| Cat.No. : | Adipoq-5373M |
| Product Overview : | Recombinant MouseAdipoq (aa 111-247) is the globular domain of Mouse Adipoq, containing 138amino acid residues from aa 111-247. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 111-247 a.a. |
| Description : | Thereare four distinct regions of Adipoq. The first is ashort signal sequence that targets the hormone for secretion outside thecell; next is a short region that varies between species; the third is a65-amino acid region with similarity to collagenous proteins; the last is aglobular domain. Overall this gene shows similarity to the complement 1Qfactors. However, when the 3-dimensional structure of the globular region wasdetermined, a striking similarity to TNFα was observed, despite unrelatedprotein sequences. |
| Form : | Liquid in 20 mMTris-HCl, pH 7.5 + 50 mM NaCl + 5 mM DTT + 10% glycerol. |
| Purity : | > 95.0% asdetermined by RP-HPLC and SDS-PAGE analyses. |
| Endotoxin Level : | < 0.1 ng/μg ofAdipoQ. |
| Amino Acid Sequence : | MAYMYRSAFSVGLETRVTVP NVPIRFTKIF YNQQNHYDGS TGKFYCNIPG LYYFSYHITVYMKDVKVSLFKKDKAVLFTY DQYQEKNVDQ ASGSVLLHLE VGDQVWLQVYGDGDHNGLYADNVNDSTFTG FLLYHDTN |
| Molecular Weight : | 16 kDa |
| Concentration : | 1 mg/ml |
| Storage : | Store at -20°C to-80°C. Avoidrepeated freeze-thaw cycles. |
| OfficialSymbol : | Adipoq |
| Gene Name | Adipoq adiponectin, C1Q andcollagen domain containing [ Mus musculus ] |
| Synonyms | Adipoq; adiponectin,C1Q and collagen domain containing; APN; Acdc; apM1; 30kDa; GBP28; adipo;Acrp30; adiponectin; OTTMUSP00000050447; adipocyte-specific protein AdipoQ;adipocyte complement related protein; 30 kDa adipocyte complement-relatedprotein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q andcollagen domain containing; adipocyte, C1q and collagen domain-containingprotein |
| Gene ID | 11450 |
| mRNA Refseq | NM_009605 |
| Protein Refseq | NP_033735 |
| Chromosome Location | 16 B3-B4;16 16.0 cM |
| Pathway | Adipocytokinesignaling pathway; Adipogenesis; Leptin and adiponectin; PPAR signalingpathway; Type II diabetes mellitus |
| Function | eukaryotic cellsurface binding; hormone activity; protein binding; protein homodimerizationactivity; receptor binding; sialic acid binding |
| ◆ Recombinant Proteins | ||
| ADIPOQ-254H | Active Recombinant Human ADIPOQ protein, His-tagged | +Inquiry |
| ADIPOQ-189D | Recombinant Dog ADIPOQ, Globular Domain, FLAG-tagged | +Inquiry |
| Adipoq-46M | Recombinant Mouse Adipoq | +Inquiry |
| ADIPOQ-087H | Recombinant Human ADIPOQ Protein, Fc-tagged | +Inquiry |
| ADIPOQ-14H | Recombinant Human ADIPOQ Protein, His/S-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ADIPOQ-215H | Native Human Adiponectin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ADIPOQ-1526HCL | Recombinant Human ADIPOQ cell lysate | +Inquiry |
| ADIPOQ-2209MCL | Recombinant Mouse ADIPOQ cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Adipoq Products
Required fields are marked with *
My Review for All Adipoq Products
Required fields are marked with *
