Recombinant Mouse Adipoq Protein, His-tagged

Cat.No. : Adipoq-032M
Product Overview : Purified recombinant protein of Mouse adiponectin, C1Q and collagen domain containing (Adipoq) with a N-His tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW.
Molecular Mass : 27.2 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of PBS,pH 7.4
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name Adipoq adiponectin, C1Q and collagen domain containing [ Mus musculus (house mouse) ]
Official Symbol Adipoq
Synonyms Adipoq; adiponectin, C1Q and collagen domain containing; Ad; APN; Acdc; Adid; apM1; 30kDa; GBP28; adipo; Acrp30; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement related protein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q and collagen domain containing; adipocyte, C1q and collagen domain-containing protein; adipocyte-specific protein AdipoQ; adiponectin d
Gene ID 11450
mRNA Refseq NM_009605
Protein Refseq NP_033735
UniProt ID Q60994

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Adipoq Products

Required fields are marked with *

My Review for All Adipoq Products

Required fields are marked with *

0

Inquiry Basket

cartIcon