Recombinant Mouse Ahsg Protein, His-tagged

Cat.No. : Ahsg-7155M
Product Overview : Recombinant mouse ahsg, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His
Protein Length : 19-345
Description : Probably involved in differentiation.
Form : Liquid
Molecular Mass : 36.1 kDa
AA Sequence : APQGTGLGFRELACDDPEAEQVALLAVDYLNNHLLQGFKQVLNQIDKVKVWSRRPFGVVYEMEVDTLETTCHALDPTPLANCSVRQLTEHAVEGDCDFHILKQDGQFRVMHTQCHSTPDSAEDVRKLCPRCPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFKLVEISRAQNVPLPVSTLVEFVIAATDCTAKEVTDPAKCNLLAEKQHGFCKANLMHNLGGEEVSVACKLFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPRGLSDHRTYHDLRHAFSPVASVESASGETLHSPKVGQPGAAGPVSPMCPGRIRHFKIHHHHHH
Endotoxin : < 1.0 EU/μg of protein (determined by LAL method)
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.25 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.
Gene Name Ahsg alpha-2-HS-glycoprotein [ Mus musculus (house mouse) ]
Official Symbol Ahsg
Synonyms Ahsg; alpha-2-HS-glycoprotein; fetui; alpha-2-HS-glycoprotein; countertrypin; fetuin-A
Gene ID 11625
mRNA Refseq NM_001276449
Protein Refseq NP_001263378
UniProt ID P29699

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ahsg Products

Required fields are marked with *

My Review for All Ahsg Products

Required fields are marked with *

0

Inquiry Basket

cartIcon