Recombinant Mouse Ahsg Protein, His-tagged

• Cat.No.: Ahsg-7155M
• Product Overview: Recombinant mouse ahsg, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.

Specification

• Species: Mouse
• Source: Insect Cells
• Tag: His
• Protein Length: 19-345
• Description: Probably involved in differentiation.
• Form: Liquid
• Molecular Mass: 36.1 kDa
• AA Sequence: APQGTGLGFRELACDDPEAEQVALLAVDYLNNHLLQGFKQVLNQIDKVKVWSRRPFGVVYEMEVDTLETTCHALDPTPLANCSVRQLTEHAVEGDCDFHILKQDGQFRVMHTQCHSTPDSAEDVRKLCPRCPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFKLVEISRAQNVPLPVSTLVEFVIAATDCTAKEVTDPAKCNLLAEKQHGFCKANLMHNLGGEEVSVACKLFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPRGLSDHRTYHDLRHAFSPVASVESASGETLHSPKVGQPGAAGPVSPMCPGRIRHFKIHHHHHH
• Endotoxin: < 1.0 EU/μg of protein (determined by LAL method)
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.25 mg/mL (determined by Bradford assay)
• Storage Buffer: Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol.

Gene Information

• Gene Name: Ahsg alpha-2-HS-glycoprotein [ Mus musculus (house mouse) ]
• Official Symbol: Ahsg
• Synonyms: Ahsg; alpha-2-HS-glycoprotein; fetui; alpha-2-HS-glycoprotein; countertrypin; fetuin-A
• Gene ID: 11625
• mRNA Refseq: NM_001276449
• Protein Refseq: NP_001263378
• UniProt ID: P29699