Recombinant Mouse Ahsg Protein, His-tagged
Cat.No. : | Ahsg-7155M |
Product Overview : | Recombinant mouse ahsg, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 19-345 |
Description : | Probably involved in differentiation. |
Form : | Liquid |
Molecular Mass : | 36.1 kDa |
AA Sequence : | APQGTGLGFRELACDDPEAEQVALLAVDYLNNHLLQGFKQVLNQIDKVKVWSRRPFGVVYEMEVDTLETTCHALDPTPLANCSVRQLTEHAVEGDCDFHILKQDGQFRVMHTQCHSTPDSAEDVRKLCPRCPLLTPFNDTNVVHTVNTALAAFNTQNNGTYFKLVEISRAQNVPLPVSTLVEFVIAATDCTAKEVTDPAKCNLLAEKQHGFCKANLMHNLGGEEVSVACKLFQTQPQPANANAVGPVPTANAALPADPPASVVVGPVVVPRGLSDHRTYHDLRHAFSPVASVESASGETLHSPKVGQPGAAGPVSPMCPGRIRHFKIHHHHHH |
Endotoxin : | < 1.0 EU/μg of protein (determined by LAL method) |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.25 mg/mL (determined by Bradford assay) |
Storage Buffer : | Phosphate Buffered Saline (pH 7.4) containing 10 % glycerol. |
Gene Name | Ahsg alpha-2-HS-glycoprotein [ Mus musculus (house mouse) ] |
Official Symbol | Ahsg |
Synonyms | Ahsg; alpha-2-HS-glycoprotein; fetui; alpha-2-HS-glycoprotein; countertrypin; fetuin-A |
Gene ID | 11625 |
mRNA Refseq | NM_001276449 |
Protein Refseq | NP_001263378 |
UniProt ID | P29699 |
◆ Recombinant Proteins | ||
AHSG-7710H | Recombinant Human AHSG protein, His-tagged | +Inquiry |
Ahsg-705M | Active Recombinant Mouse Ahsg protein(Met1-Ile345), His-tagged | +Inquiry |
AHSG-3000H | Recombinant Human AHSG Protein (Cys16-Pro382), C-His tagged | +Inquiry |
AHSG-565H | Recombinant Human alpha-2-HS-glycoprotein, His-tagged | +Inquiry |
Ahsg-674M | Active Recombinant Mouse Ahsg Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
AHSG-111H | Native Human Alpha 2 HS Glycoprotein | +Inquiry |
AHSG-1001H | Human Leucine-rich Alpha-2-glycoprotein 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
AHSG-2958HCL | Recombinant Human AHSG cell lysate | +Inquiry |
AHSG-2957MCL | Recombinant Mouse AHSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ahsg Products
Required fields are marked with *
My Review for All Ahsg Products
Required fields are marked with *
0
Inquiry Basket