Recombinant Mouse Aif1 protein, hFc-tagged
| Cat.No. : | Aif1-2433M |
| Product Overview : | Recombinant Mouse Aif1 protein(O70200)(2-147aa), fused with C-terminal hFc tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 2-147aa |
| Tag : | C-hFc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 45.7 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. Greater than 90% as determined by SEC-HPLC. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP |
| Gene Name | Aif1 allograft inflammatory factor 1 [ Mus musculus ] |
| Official Symbol | Aif1 |
| Synonyms | AIF1; allograft inflammatory factor 1; testis specific; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; G1; Iba1; AIF-1; AI607846; D17H6S50E; |
| Gene ID | 11629 |
| mRNA Refseq | NM_019467 |
| Protein Refseq | NP_062340 |
| ◆ Recombinant Proteins | ||
| Aif1-3277M | Recombinant Mouse Aif1, His-tagged | +Inquiry |
| AIF1-100H | Recombinant Human AIF1, His-tagged | +Inquiry |
| Aif1-2497M | Recombinant Mouse Aif1 protein, His-tagged | +Inquiry |
| AIF1-2496H | Recombinant Human AIF1 protein, His-SUMO-tagged | +Inquiry |
| AIF1-0310H | Recombinant Human AIF1 Protein (Ser2-Pro147), C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AIF1-8956HCL | Recombinant Human AIF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Aif1 Products
Required fields are marked with *
My Review for All Aif1 Products
Required fields are marked with *
