Recombinant Mouse Aif1 protein, His-tagged
| Cat.No. : | Aif1-2497M |
| Product Overview : | Recombinant Mouse Aif1 protein(O70200)(2-147aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 2-147aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 20.8 kDa |
| AA Sequence : | SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Aif1 allograft inflammatory factor 1 [ Mus musculus ] |
| Official Symbol | Aif1 |
| Synonyms | AIF1; allograft inflammatory factor 1; testis specific; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; G1; Iba1; AIF-1; AI607846; D17H6S50E; |
| Gene ID | 11629 |
| mRNA Refseq | NM_019467 |
| Protein Refseq | NP_062340 |
| ◆ Recombinant Proteins | ||
| Aif1-647M | Recombinant Mouse Aif1 protein, His-tagged | +Inquiry |
| Aif1-2497M | Recombinant Mouse Aif1 protein, His-tagged | +Inquiry |
| AIF1-1449M | Recombinant Mouse AIF1 Protein | +Inquiry |
| AIF1-1323R | Recombinant Rat AIF1 Protein (2-147 aa), His-tagged | +Inquiry |
| AIF1-100H | Recombinant Human AIF1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AIF1-8956HCL | Recombinant Human AIF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Aif1 Products
Required fields are marked with *
My Review for All Aif1 Products
Required fields are marked with *
