Recombinant Mouse Aif1 protein, His-tagged
Cat.No. : | Aif1-647M |
Product Overview : | Recombinant Mouse Aif1 protein(O70200)(2-147aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-147aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SQSRDLQGGKAFGLLKAQQEERLEGINKQFLDDPKYSNDEDLPSKLEAFKVKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKRLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHKRPTGPPAKKAISELP |
Gene Name | Aif1 allograft inflammatory factor 1 [ Mus musculus ] |
Official Symbol | Aif1 |
Synonyms | AIF1; allograft inflammatory factor 1; testis specific; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; G1; Iba1; AIF-1; AI607846; D17H6S50E; |
Gene ID | 11629 |
mRNA Refseq | NM_019467 |
Protein Refseq | NP_062340 |
◆ Recombinant Proteins | ||
AIF1-1449M | Recombinant Mouse AIF1 Protein | +Inquiry |
AIF1-231R | Recombinant Rat AIF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Aif1-509R | Recombinant Rat Aif1 Protein, His-tagged | +Inquiry |
AIF1-472H | Recombinant Human AIF1 Protein, GST-tagged | +Inquiry |
Aif1-3277M | Recombinant Mouse Aif1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIF1-8956HCL | Recombinant Human AIF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Aif1 Products
Required fields are marked with *
My Review for All Aif1 Products
Required fields are marked with *