Recombinant Rat Aif1 protein, His-SUMO-tagged
Cat.No. : | Aif1-2498R |
Product Overview : | Recombinant Rat Aif1 protein(P55009)(2-147aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 2-147aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.7 kDa |
AA Sequence : | SQSKDLQGGKAFGLLKAQQEERLDGINKHFLDDPKYSSDEDLQSKLEAFKTKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIREVSSGSEETFSYSDFLRMMLGKRSAILRMILMYEEKNKEHQKPTGPPAKKAISELP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Aif1 allograft inflammatory factor 1 [ Rattus norvegicus ] |
Official Symbol | Aif1 |
Synonyms | AIF1; allograft inflammatory factor 1; protein BART-1; AIF-1; microglia response factor; balloon angioplasty responsive transcript; ionized calcium binding adapter molecule 1; ionized calcium-binding adapter molecule 1; balloon angioplasty-responsive transcript 1; iba1; Bart1; mrf-1; |
Gene ID | 29427 |
mRNA Refseq | NM_017196 |
Protein Refseq | NP_058892 |
◆ Recombinant Proteins | ||
AIF1-6900H | Recombinant Human Allograft Inflammatory Factor 1, His-tagged | +Inquiry |
AIF1-0311H | Recombinant Human AIF1 Protein (Met1-Pro147), His-tagged | +Inquiry |
Aif1-3277M | Recombinant Mouse Aif1, His-tagged | +Inquiry |
AIF1-278R | Recombinant Rhesus monkey AIF1 Protein, His-tagged | +Inquiry |
AIF1-8643H | Recombinant Human AIF1 protein(Met1-Pro147), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AIF1-8956HCL | Recombinant Human AIF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Aif1 Products
Required fields are marked with *
My Review for All Aif1 Products
Required fields are marked with *