Recombinant Mouse Angptl4 protein, His-tagged

Cat.No. : Angptl4-6343M
Product Overview : Recombinant Mouse Angptl4 protein(Q9Z1P8)(24-410aa), fused with C-terminal His tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 24-410a.a.
Tag : His
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 44.4 kDa
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : QGRPAQPEPPRFASWDEMNLLAHGLLQLGHGLREHVERTRGQLGALERRMAACGNACQGPKGKDAPFKDSEDRVPEGQTPETLQSLQTQLKAQNSKIQQLFQKVAQQQRYLSKQNLRIQNLQSQIDLLAPTHLDNGVDKTSRGKRLPKMTQLIGLTPNATHLHRPPRDCQELFQEGERHSGLFQIQPLGSPPFLVNCEMTSDGGWTVIQRRLNGSVDFNQSWEAYKDGFGDPQGEFWLGLEKMHSITGNRGSQLAVQLQDWDGNAKLLQFPIHLGGEDTAYSLQLTEPTANELGATNVSPNGLSLPFSTWDQDHDLRGDLNCAKSLSGGWWFGTCSHSNLNGQYFHSIPRQRQERKKGIFWKTWKGRYYPLQATTLLIQPMEATAAS
Gene Name Angptl4 angiopoietin-like 4 [ Mus musculus ]
Official Symbol Angptl4
Synonyms ANGPTL4; angiopoietin-like 4; angiopoietin-related protein 4; 425O18-1; secreted protein Bk89; angiopoietin-like protein 4; fasting-induced adipose factor; fibrinogen/angiopoietin-related protein; major histocompatibility complex region NG27; hepatic fibrinogen/angiopoietin-related protein; Arp4; Bk89; Fiaf; Ng27; Pgar; Hfarp; Pgarg; Pp1158;
Gene ID 57875
mRNA Refseq NM_020581
Protein Refseq NP_065606

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Angptl4 Products

Required fields are marked with *

My Review for All Angptl4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon