Recombinant Mouse Apoa1 Protein, His-tagged
Cat.No. : | Apoa1-7166M |
Product Overview : | Recombinant Mouse Apoa1 protein with a His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-264 |
Description : | This gene encodes a preproprotein that is proteolytically cleaved to yield a signal peptide and a proproptein that is subsequently processed to generate the active mature peptide. The encoded protein is the major protein component of plasma high density lipoprotein (HDL). This protein facilitates the removal of cholesterol and other fats from tissues by transporting them to the liver for excretion. This protein is a cofactor for lecithin cholesterolacyltransferase, an enzyme that catalyzes the conversion of free cholesterol to cholesteryl esters. Mutations in this gene in humans causes familial HDL deficiency, Tangier disease and familial visceral amyloidosis. Similar clinical features are exhibited by mice with mutations in this gene. This gene is clustered with three other apolipoprotein genes on chromosome 9. |
Form : | Liquid |
Molecular Mass : | 30.3 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by bradford assay) |
Storage Buffer : | In Phosphate buffered saline (pH7.4) containing 20 % glycerol, 1 mM DTT. |
Gene Name | Apoa1 apolipoprotein A-I [ Mus musculus (house mouse) ] |
Official Symbol | Apoa1 |
Synonyms | Apoa1; apolipoprotein A-I; Al; Ap; Se; Sep; Brp-; Ltw-; Lvtw; Sep2; Alp-1; Ltw-1; Sep-1; Sep-2; Apoa-1; Brp-14; Lvtw-1; apo-AI; apoA-Iapolipoprotein A-I; apolipoprotein A1 |
Gene ID | 11806 |
mRNA Refseq | NM_009692 |
Protein Refseq | NP_033822 |
UniProt ID | Q00623 |
◆ Recombinant Proteins | ||
Apoa1-38M | Recombinant Mouse Apoa1, His-tagged | +Inquiry |
APOA1-0639H | Recombinant Human APOA1 Protein (Arg19-Gln267 ), C-His-tagged | +Inquiry |
APOA1-2726R | Recombinant Rabbit APOA1 protein, His-tagged | +Inquiry |
Apoa1-631M | Recombinant Mouse Apoa1 Protein, MYC/DDK-tagged | +Inquiry |
APOA1-9747H | Recombinant Human APOA1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
ApoA-I-3554H | Native Human ApoA-I | +Inquiry |
APOA1-5301H | Native Human Apolipoprotein A-I | +Inquiry |
APOA1-23D | Native Dog Apolipoprotein A1 (APOA1) Protein | +Inquiry |
APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
APOA1-26121TH | Native Human APOA1, Protein A-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOA1-1497MCL | Recombinant Mouse APOA1 cell lysate | +Inquiry |
APOA1-3088HCL | Recombinant Human APOA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Apoa1 Products
Required fields are marked with *
My Review for All Apoa1 Products
Required fields are marked with *