Recombinant Mouse Apoa1 Protein, His-tagged

Cat.No. : Apoa1-7166M
Product Overview : Recombinant Mouse Apoa1 protein with a His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 25-264
Description : This gene encodes a preproprotein that is proteolytically cleaved to yield a signal peptide and a proproptein that is subsequently processed to generate the active mature peptide. The encoded protein is the major protein component of plasma high density lipoprotein (HDL). This protein facilitates the removal of cholesterol and other fats from tissues by transporting them to the liver for excretion. This protein is a cofactor for lecithin cholesterolacyltransferase, an enzyme that catalyzes the conversion of free cholesterol to cholesteryl esters. Mutations in this gene in humans causes familial HDL deficiency, Tangier disease and familial visceral amyloidosis. Similar clinical features are exhibited by mice with mutations in this gene. This gene is clustered with three other apolipoprotein genes on chromosome 9.
Form : Liquid
Molecular Mass : 30.3 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by bradford assay)
Storage Buffer : In Phosphate buffered saline (pH7.4) containing 20 % glycerol, 1 mM DTT.
Gene Name Apoa1 apolipoprotein A-I [ Mus musculus (house mouse) ]
Official Symbol Apoa1
Synonyms Apoa1; apolipoprotein A-I; Al; Ap; Se; Sep; Brp-; Ltw-; Lvtw; Sep2; Alp-1; Ltw-1; Sep-1; Sep-2; Apoa-1; Brp-14; Lvtw-1; apo-AI; apoA-Iapolipoprotein A-I; apolipoprotein A1
Gene ID 11806
mRNA Refseq NM_009692
Protein Refseq NP_033822
UniProt ID Q00623

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Apoa1 Products

Required fields are marked with *

My Review for All Apoa1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon