Recombinant Mouse Apoc3 Protein, His-SUMO-tagged

PRODUCTS

Home / Products / Recombinant Mouse Apoc3 Protein, His-SUMO-tagged

Recombinant Mouse Apoc3 Protein, His-SUMO-tagged

Apoc3 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Apoc3-1126M
Product Overview : Recombinant Mouse Apoc3 Protein (21-99aa) was expressed in E. coli with N-terminal His-SUMO-tag.
Description : This gene encodes an apolipoprotein which is the major protein component of very-low-density lipoproteins (VLDL) and a minor component of high-density lipoproteins (HDL). The encoded protein is thought to regulate the metabolism of triglyceride-rich lipoproteins and play a role in lipid storage and the mobilization of fat cells. This gene is clustered with three other apolipoprotein genes on chromosome 9 and is associated with coronary disease. Mice lacking this gene have lower levels of total cholesterol in the plasma. Mutations in the human genes causes hyperalphalipoproteinemia 2, a disorder of lipid metabolism which results in a favorable lipid profile (lower LDL-cholesterol, higher HDL-cholesterol and lower levels of serum triglycerides when fasting and after a meal). Alternative splicing results in multiple transcript variants.
Source : E. coli
Species : Mouse
Tag : His-SUMO
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 24.9 kDa
AA Sequence : EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPE
DQPTPAIES
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name : Apoc3 apolipoprotein C-III [ Mus musculus (house mouse) ]
Official Symbol : Apoc3
Synonyms : apo-CIII; apoC-III; apolipoprotein C3; apolipoprotein C-III
Gene ID : 11814
mRNA Refseq : NM_023114.3
Protein Refseq : NP_075603.1
UniProt ID : P33622

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.