Recombinant Mouse Apoc3 Protein, His-SUMO-tagged
Cat.No. : | Apoc3-1126M |
Product Overview : | Recombinant Mouse Apoc3 Protein (21-99aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 21-99 a.a. |
Description : | This gene encodes an apolipoprotein which is the major protein component of very-low-density lipoproteins (VLDL) and a minor component of high-density lipoproteins (HDL). The encoded protein is thought to regulate the metabolism of triglyceride-rich lipoproteins and play a role in lipid storage and the mobilization of fat cells. This gene is clustered with three other apolipoprotein genes on chromosome 9 and is associated with coronary disease. Mice lacking this gene have lower levels of total cholesterol in the plasma. Mutations in the human genes causes hyperalphalipoproteinemia 2, a disorder of lipid metabolism which results in a favorable lipid profile (lower LDL-cholesterol, higher HDL-cholesterol and lower levels of serum triglycerides when fasting and after a meal). Alternative splicing results in multiple transcript variants. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 24.9 kDa |
AA Sequence : | EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPE DQPTPAIES |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | Apoc3 apolipoprotein C-III [ Mus musculus (house mouse) ] |
Official Symbol | Apoc3 |
Synonyms | apo-CIII; apoC-III; apolipoprotein C3; apolipoprotein C-III |
Gene ID | 11814 |
mRNA Refseq | NM_023114.3 |
Protein Refseq | NP_075603.1 |
UniProt ID | P33622 |
◆ Recombinant Proteins | ||
APOC3-362H | Recombinant Human APOC3 protein | +Inquiry |
APOC3-1789M | Recombinant Mouse APOC3 Protein | +Inquiry |
APOC3-0638H | Recombinant Human APOC3 Protein, Tag Free | +Inquiry |
Apoc3-1939M | Recombinant Mouse Apoc3 protein, His-tagged | +Inquiry |
APOC3-2198C | Recombinant Cynomolgus monkey APOC3 protein, MBP&His-tagged | +Inquiry |
◆ Native Proteins | ||
APOC3-669H | Native Human APOC3 protein | +Inquiry |
APOC3-361H | Native Human Apolipoprotein C-III | +Inquiry |
APOC3-8040H | Native Human ApoLipoprotein CIII | +Inquiry |
ApoC-III-3559H | Native Human ApoC-III | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC3-8782HCL | Recombinant Human APOC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Apoc3 Products
Required fields are marked with *
My Review for All Apoc3 Products
Required fields are marked with *
0
Inquiry Basket