Recombinant Mouse AQP4 Protein (253-323 aa), His-tagged
Cat.No. : | AQP4-2226M |
Product Overview : | Recombinant Mouse AQP4 Protein (253-323 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 253-323 aa |
Description : | Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 9.9 kDa |
AA Sequence : | CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Aqp4 aquaporin 4 [ Mus musculus ] |
Official Symbol | AQP4 |
Synonyms | AQP4; aquaporin 4; aquaporin-4; AQP-4; mercurial-insensitive water channel; WCH4; |
Gene ID | 11829 |
mRNA Refseq | NM_009700 |
Protein Refseq | NP_033830 |
UniProt ID | P55088 |
◆ Recombinant Proteins | ||
AQP4-0294H | Recombinant Human AQP4 Protein (Met23-Val323), C-GFP-tagged | +Inquiry |
Aqp4-3600M | Recombinant Mouse Aqp4, His-tagged | +Inquiry |
AQP4-1088Z | Recombinant Zebrafish AQP4 | +Inquiry |
AQP4-203R | Recombinant Rhesus Macaque AQP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Aqp4-5345M | Recombinant Mouse Aqp4 protein, His-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AQP4-32HCL | Recombinant Human AQP4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AQP4 Products
Required fields are marked with *
My Review for All AQP4 Products
Required fields are marked with *
0
Inquiry Basket