Recombinant Mouse AQP4 Protein (253-323 aa), His-tagged

Cat.No. : AQP4-2226M
Product Overview : Recombinant Mouse AQP4 Protein (253-323 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Yeast
Tag : His
Protein Length : 253-323 aa
Description : Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 9.9 kDa
AA Sequence : CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name Aqp4 aquaporin 4 [ Mus musculus ]
Official Symbol AQP4
Synonyms AQP4; aquaporin 4; aquaporin-4; AQP-4; mercurial-insensitive water channel; WCH4;
Gene ID 11829
mRNA Refseq NM_009700
Protein Refseq NP_033830
UniProt ID P55088

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AQP4 Products

Required fields are marked with *

My Review for All AQP4 Products

Required fields are marked with *

0
cart-icon