Recombinant Mouse AQP4 Protein (253-323 aa), His-tagged

• Cat.No.: AQP4-2226M
• Product Overview: Recombinant Mouse AQP4 Protein (253-323 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.

Specification

• Species: Mouse
• Source: Yeast
• Tag: His
• Protein Length: 253-323 aa
• Description: Forms a water-specific channel. Osmoreceptor which regulates body water balance and mediates water flow within the central nervous system.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 9.9 kDa
• AA Sequence: CPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGEEKKGKDSSGEVLSSV
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: Aqp4 aquaporin 4 [ Mus musculus ]
• Official Symbol: AQP4
• Synonyms: AQP4; aquaporin 4; aquaporin-4; AQP-4; mercurial-insensitive water channel; WCH4
• Gene ID: 11829
• mRNA Refseq: NM_009700
• Protein Refseq: NP_033830
• UniProt ID: P55088