Recombinant Mouse Asah1 protein, His-SUMO & Myc-tagged
Cat.No. : | Asah1-2473M |
Product Overview : | Recombinant Mouse Asah1 protein(Q9WV54)(19-141aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 19-141aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.8 kDa |
AA Sequence : | QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Asah1 N-acylsphingosine amidohydrolase 1 [ Mus musculus ] |
Official Symbol | Asah1 |
Synonyms | ASAH1; N-acylsphingosine amidohydrolase 1; acid ceramidase; ACDase; acid CDase; acylsphingosine deacylase; AC; Asah; 2310081N20Rik; |
Gene ID | 11886 |
mRNA Refseq | NM_019734 |
Protein Refseq | NP_062708 |
◆ Recombinant Proteins | ||
ASAH1-26424TH | Recombinant Human ASAH1 | +Inquiry |
ASAH1-814R | Recombinant Rat ASAH1 Protein | +Inquiry |
ASAH1-1593C | Recombinant Chicken ASAH1 | +Inquiry |
ASAH1-3526H | Recombinant Human ASAH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ASAH1-470R | Recombinant Rat ASAH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
ASAH1-13HFL | Recombinant Full Length Human ASAH1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASAH1-8670HCL | Recombinant Human ASAH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Asah1 Products
Required fields are marked with *
My Review for All Asah1 Products
Required fields are marked with *
0
Inquiry Basket