Recombinant Mouse Asah1 protein, His-SUMO & Myc-tagged

• Cat.No.: Asah1-2473M
• Product Overview: Recombinant Mouse Asah1 protein(Q9WV54)(19-141aa), fused to N-terminal His-SUMO tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 19-141aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 33.8 kDa
• AA Sequence: QAQDVPPWTEDCRKSTYPPSGPTYRGPVPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTM
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: Asah1 N-acylsphingosine amidohydrolase 1 [ Mus musculus ]
• Official Symbol: Asah1
• Synonyms: ASAH1; N-acylsphingosine amidohydrolase 1; acid ceramidase; ACDase; acid CDase; acylsphingosine deacylase; AC; Asah; 2310081N20Rik
• Gene ID: 11886
• mRNA Refseq: NM_019734
• Protein Refseq: NP_062708