Recombinant Mouse Asgr1 protein, GST-tagged
| Cat.No. : | Asgr1-2556M |
| Product Overview : | Recombinant Mouse Asgr1 protein(P34927)(61-284aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 61-284aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 52.8 kDa |
| AA Sequence : | QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Asgr1 asialoglycoprotein receptor 1 [ Mus musculus ] |
| Official Symbol | Asgr1 |
| Synonyms | ASGR1; asialoglycoprotein receptor 1; HL-1; mHL-1; ASGPR 1; ASGP-R 1; hepatic lectin 1; Asgr; ASGPR1; Asgr-1; |
| Gene ID | 11889 |
| mRNA Refseq | NM_009714 |
| Protein Refseq | NP_033844 |
| ◆ Recombinant Proteins | ||
| RFL-36206RF | Recombinant Full Length Rat Asialoglycoprotein Receptor 1(Asgr1) Protein, His-Tagged | +Inquiry |
| ASGR1-2160M | Recombinant Mouse ASGR1 protein, His-tagged | +Inquiry |
| ASGR1-388H | Recombinant Human ASGR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ASGR1-251H | Active Recombinant Human ASGR1 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| Asgr1-656M | Recombinant Mouse Asgr1 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ASGR1-1601HCL | Recombinant Human ASGR1 cell lysate | +Inquiry |
| ASGR1-3084MCL | Recombinant Mouse ASGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Asgr1 Products
Required fields are marked with *
My Review for All Asgr1 Products
Required fields are marked with *
