Recombinant Mouse Asgr1 protein, GST-tagged
Cat.No. : | Asgr1-2556M |
Product Overview : | Recombinant Mouse Asgr1 protein(P34927)(61-284aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | GST |
Protein Length : | 61-284aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 52.8 kDa |
AA Sequence : | QNSQLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQLVSDVRSLSCQMAAFRGNGSERTCCPINWVEYEGSCYWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQNFLQRHMGPLNTWIGLTDQNGPWKWVDGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAHFTTDGRWNDDVCRRPYRWVCETKLDKAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Asgr1 asialoglycoprotein receptor 1 [ Mus musculus ] |
Official Symbol | Asgr1 |
Synonyms | ASGR1; asialoglycoprotein receptor 1; HL-1; mHL-1; ASGPR 1; ASGP-R 1; hepatic lectin 1; Asgr; ASGPR1; Asgr-1; |
Gene ID | 11889 |
mRNA Refseq | NM_009714 |
Protein Refseq | NP_033844 |
◆ Recombinant Proteins | ||
Asgr1-5347M | Recombinant Mouse Asgr1 protein, His-tagged | +Inquiry |
Asgr1-929R | Recombinant Rat Asgr1 protein, His&Myc-tagged | +Inquiry |
ASGR1-5317H | Recombinant Human ASGR1 protein, His-tagged | +Inquiry |
ASGR1-26517TH | Recombinant Human ASGR1, His-tagged | +Inquiry |
RFL-8089MF | Recombinant Full Length Mouse Asialoglycoprotein Receptor 1(Asgr1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASGR1-3084MCL | Recombinant Mouse ASGR1 cell lysate | +Inquiry |
ASGR1-1601HCL | Recombinant Human ASGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Asgr1 Products
Required fields are marked with *
My Review for All Asgr1 Products
Required fields are marked with *
0
Inquiry Basket