Recombinant Mouse ASGR2 protein, His-SUMO & Myc-tagged

• Cat.No.: ASGR2-2557M
• Product Overview: Recombinant Mouse ASGR2 protein(P24721)(80-301aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 80-301aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 45.9 kDa
• AA Sequence: QSIQLQEEFRTLKETFSNFSSSTLMEFGALDTLGGSTNAILTSWLAQLEEKQQQLKADHSTLLFHLKHFPMDLRTLTCQLAYFQSNGTECCPVNWVEFGGSCYWFSRDGLTWAEADQYCQLENAHLLVINSREEQDFVVKHRSQFHIWIGLTDRDGSWKWVDGTDYRSNYRNWAFTQPDNWQGHEQGGGEDCAEILSDGHWNDNFCQQVNRWVCEKRRNITH
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: Asgr2 asialoglycoprotein receptor 2 [ Mus musculus ]
• Official Symbol: ASGR2
• Synonyms: ASGR2; asialoglycoprotein receptor 2; HL-2; mHL-2; ASGPR 2; ASGP-R 2; hepatic lectin 2; Asgr; ASGPR2; Asgr-2
• Gene ID: 11890
• mRNA Refseq: NM_007493
• Protein Refseq: NP_031519