Recombinant Mouse Bglap protein, His-SUMO-tagged
Cat.No. : | Bglap-2589M |
Product Overview : | Recombinant Mouse Bglap protein(P86546)(50-95aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 50-95aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.1 kDa |
AA Sequence : | YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Bglap bone gamma carboxyglutamate protein [ Mus musculus ] |
Official Symbol | Bglap |
Synonyms | BGLAP; bone gamma carboxyglutamate protein; osteocalcin; BGP; bone Gla protein; bone gamma carboxyglutamate protein 1; gamma-carboxyglutamic acid-containing protein; OC; OG1; mOC-A; Bglap1; Bglap2; |
Gene ID | 12096 |
mRNA Refseq | NM_001037939 |
Protein Refseq | NP_001033028 |
◆ Recombinant Proteins | ||
Bglap-1262M | Recombinant Mouse Bglap Protein, His-tagged | +Inquiry |
Bglap-16R | Recombinant Rat Bglap protein, His-GST-tagged | +Inquiry |
BGLAP-5077H | Recombinant Human BGLAP Protein (Lys24-Val100), N-His tagged | +Inquiry |
Bglap-2589M | Recombinant Mouse Bglap protein, His-SUMO-tagged | +Inquiry |
Bglap-1143R | Recombinant Rat Bglap Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
BGLAP-57H | Native Human Osteocalcin | +Inquiry |
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
BGLAP-8519B | Native Bovine BGLAP | +Inquiry |
BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
◆ Cell & Tissue Lysates | ||
BGLAP-8460HCL | Recombinant Human BGLAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Bglap Products
Required fields are marked with *
My Review for All Bglap Products
Required fields are marked with *
0
Inquiry Basket