Recombinant Mouse Bglap protein, His-SUMO-tagged
| Cat.No. : | Bglap-2589M |
| Product Overview : | Recombinant Mouse Bglap protein(P86546)(50-95aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 50-95aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 21.1 kDa |
| AA Sequence : | YLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Bglap bone gamma carboxyglutamate protein [ Mus musculus ] |
| Official Symbol | Bglap |
| Synonyms | BGLAP; bone gamma carboxyglutamate protein; osteocalcin; BGP; bone Gla protein; bone gamma carboxyglutamate protein 1; gamma-carboxyglutamic acid-containing protein; OC; OG1; mOC-A; Bglap1; Bglap2; |
| Gene ID | 12096 |
| mRNA Refseq | NM_001037939 |
| Protein Refseq | NP_001033028 |
| ◆ Recombinant Proteins | ||
| BGLAP-1472H | Recombinant Human BGLAP protein, His/GST-tagged | +Inquiry |
| BGLAP-613HF | Recombinant Full Length Human BGLAP Protein, GST-tagged | +Inquiry |
| BGLAP-2141H | Recombinant Human BGLAP Protein, His-tagged | +Inquiry |
| Bglap-1143R | Recombinant Rat Bglap Protein, GST-tagged | +Inquiry |
| BGLAP-5633HFL | Recombinant Full Length Human BGLAP protein, Flag-tagged | +Inquiry |
| ◆ Native Proteins | ||
| BGLAP-60H | Native Human BGLAP protein | +Inquiry |
| BGLAP-57H | Native Human Osteocalcin | +Inquiry |
| BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
| BGLAP-8519B | Native Bovine BGLAP | +Inquiry |
| BGLAP-286B | Native Bovine Osteocalcin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BGLAP-8460HCL | Recombinant Human BGLAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bglap Products
Required fields are marked with *
My Review for All Bglap Products
Required fields are marked with *
