Recombinant Mouse Bicd2 protein, GST-tagged
| Cat.No. : | Bicd2-435M |
| Product Overview : | Recombinant Mouse Bicd2 protein(Q921C5)(660-813aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 660-813aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44.3 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | AVDKDKEALMEEILKLKSLLSTKREQITTLRTVLKANKQTAEVALANLKSKYENEKAMVTETMMKLRNELKALKEDAATFSSLRAMFATRCDEYITQLDEMQRQLAAAEDEKKTLNSLLRMAIQQKLALTQRLELLELDHEQTRRGRSKAASKA |
| Gene Name | Bicd2 bicaudal D homolog 2 (Drosophila) [ Mus musculus ] |
| Official Symbol | Bicd2 |
| Synonyms | BICD2; bicaudal D homolog 2 (Drosophila); protein bicaudal D homolog 2; bic-D 2; AA408834; mKIAA0699; 0610027D24Rik; 1110005D12Rik; KIAA0699; |
| Gene ID | 76895 |
| mRNA Refseq | NM_001039179 |
| Protein Refseq | NP_001034268 |
| ◆ Recombinant Proteins | ||
| BICD2-367R | Recombinant Rhesus Macaque BICD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| BICD2-6865H | Recombinant Human BICD2 protein, His-tagged | +Inquiry |
| BICD2-6866H | Recombinant Human BICD2 protein, GST-tagged | +Inquiry |
| BICD2-539R | Recombinant Rhesus monkey BICD2 Protein, His-tagged | +Inquiry |
| Bicd2-435M | Recombinant Mouse Bicd2 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bicd2 Products
Required fields are marked with *
My Review for All Bicd2 Products
Required fields are marked with *
