Recombinant Mouse Birc5 protein, His-SUMO-tagged
| Cat.No. : | Birc5-2594M |
| Product Overview : | Recombinant Mouse Birc5 protein(O70201)(1-140aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-140aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 32.3 kDa |
| AA Sequence : | MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Birc5 baculoviral IAP repeat-containing 5 [ Mus musculus ] |
| Official Symbol | Birc5 |
| Synonyms | BIRC5; baculoviral IAP repeat-containing 5; baculoviral IAP repeat-containing protein 5; survivin; apoptosis inhibitor 4; apoptosis inhibitor survivin; Api4; TIAP; AAC-11; survivin40; |
| Gene ID | 11799 |
| mRNA Refseq | NM_001012273 |
| Protein Refseq | NP_001012273 |
| ◆ Recombinant Proteins | ||
| BIRC5-018HFL | Recombinant Full Length Human BIRC5 Protein, His&TEV tagged | +Inquiry |
| BIRC5-5592H | Recombinant Human BIRC5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Birc5-162M | Recombinant Mouse Birc5 Protein, His-tagged | +Inquiry |
| BIRC5-047H | Recombinant Human BIRC5 Protein | +Inquiry |
| BIRC5-31754TH | Recombinant Human BIRC5 Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BIRC5-8449HCL | Recombinant Human BIRC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Birc5 Products
Required fields are marked with *
My Review for All Birc5 Products
Required fields are marked with *
