Recombinant Mouse Birc5 protein, His-SUMO-tagged
Cat.No. : | Birc5-2594M |
Product Overview : | Recombinant Mouse Birc5 protein(O70201)(1-140aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-140aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 32.3 kDa |
AA Sequence : | MGAPALPQIWQLYLKNYRIATFKNWPFLEDCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDNPIEEHRKHSPGCAFLTVKKQMEELTVSEFLKLDRQRAKNKIAKETNNKQKEFEETAKTTRQSIEQLAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Birc5 baculoviral IAP repeat-containing 5 [ Mus musculus ] |
Official Symbol | Birc5 |
Synonyms | BIRC5; baculoviral IAP repeat-containing 5; baculoviral IAP repeat-containing protein 5; survivin; apoptosis inhibitor 4; apoptosis inhibitor survivin; Api4; TIAP; AAC-11; survivin40; |
Gene ID | 11799 |
mRNA Refseq | NM_001012273 |
Protein Refseq | NP_001012273 |
◆ Recombinant Proteins | ||
BIRC5-18H | Recombinant Human BIRC5 Protein, His-tagged | +Inquiry |
BIRC5-2465H | Recombinant Human BIRC5 protein(41-130 aa), N-mSUMO & C-His-tagged | +Inquiry |
BIRC5-7313HFL | Recombinant Full Length Human BIRC5 protein, Flag-tagged | +Inquiry |
BIRC5-2593H | Recombinant Human BIRC5 protein, His-SUMO-tagged | +Inquiry |
BIRC5-376H | Recombinant Human baculoviral IAP repeat-containing 5, CaM-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BIRC5-8449HCL | Recombinant Human BIRC5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Birc5 Products
Required fields are marked with *
My Review for All Birc5 Products
Required fields are marked with *
0
Inquiry Basket