Recombinant Mouse Bmp3 protein, Myc-tagged
Cat.No. : | Bmp3-2599M |
Product Overview : | Recombinant Mouse Bmp3 protein(Q8BHE5)(359-468aa), fused to C-terminal myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Myc |
Protein Length : | 359-468aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 13.9 kDa |
AA Sequence : | QWVEPRNCARRYLKVDFADIGWSEWIISPKSFDAFYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVSGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Bmp3 bone morphogenetic protein 3 [ Mus musculus ] |
Official Symbol | Bmp3 |
Synonyms | BMP3; bone morphogenetic protein 3; |
Gene ID | 12158 |
◆ Recombinant Proteins | ||
BMP3-3376M | Recombinant Mouse BMP3 protein, His-tagged | +Inquiry |
Bmp3-2599M | Recombinant Mouse Bmp3 protein, Myc-tagged | +Inquiry |
BMP3-4846Z | Recombinant Zebrafish BMP3 | +Inquiry |
BMP3-2588M | Recombinant Mouse BMP3 Protein (359-468 aa), His-tagged | +Inquiry |
BMP3-278H | Active Recombinant Human BMP3 Protein (Gln363-Arg472), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP3-8433HCL | Recombinant Human BMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Bmp3 Products
Required fields are marked with *
My Review for All Bmp3 Products
Required fields are marked with *
0
Inquiry Basket