Recombinant Mouse CBS Protein (2-561 aa), His-tagged
Cat.No. : | CBS-1960M |
Product Overview : | Recombinant Mouse CBS Protein (2-561 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cancer. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 2-561 aa |
Description : | Hydro-lyase catalyzing the first step of the transsulfuration pathway, where the hydroxyl group of L-serine is displaced by L-homocysteine in a beta-replacement reaction to form L-cystathionine, the precursor of L-cysteine. This catabolic route allows the elimination of L-methionine and the toxic metabolite L-homocysteine (By similarity). Also involved in the production of hydrogen sulfide, a gasotransmitter with signaling and cytoprotective effects on neurons. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 63.4 kDa |
AA Sequence : | PSGTSQCEDGSAGGFQHLDMHSEKRQLEKGPSGDKDRVWIRPDTPSRCTWQLGRAMADSPHYHTVLTKSPKILPDILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPGDTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDDTAEEILQQCDGKLDMLVASAGTGGTITGIARKLKEKCPGCKIIGVDPEGSILAEPEELNQTEQTAYEVEGIGYDFIPTVLDRAVVDKWFKSNDEDSFAFARMLIAQEGLLCGGSSGSAMAVAVKAARELQEGQRCVVILPDSVRNYMSKFLSDKWMLQKGFMKEELSVKRPWWWRLRVQELSLSAPLTVLPTVTCEDTIAILREKGFDQAPVVNESGAILGMVTLGNMLSSLLAGKVRPSDEVCKVLYKQFKPIHLTDTLGTLSHILEMDHFALVVHEQIQSRDQAWSGVVGGPTDCSNGMSSKQQMVFGVVTAIDLLNFVAAREQTQT |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Cbs cystathionine beta-synthase [ Mus musculus ] |
Official Symbol | CBS |
Synonyms | CBS; beta-thionase; HIP4; AI047524; AI303044; MGC18856; MGC18895; MGC37300; |
Gene ID | 12411 |
mRNA Refseq | NM_144855 |
Protein Refseq | NP_659104 |
UniProt ID | Q91WT9 |
◆ Recombinant Proteins | ||
CBS-2644H | Recombinant Human CBS protein, His-SUMO-tagged | +Inquiry |
Cbs-4715M | Recombinant Mouse Cbs protein, His-SUMO-tagged | +Inquiry |
CBS-2776HF | Recombinant Full Length Human CBS Protein, GST-tagged | +Inquiry |
CBS-0471H | Recombinant Human CBS Protein, GST-Tagged | +Inquiry |
CBS-5361H | Recombinant Human CBS protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CBS-7809HCL | Recombinant Human CBS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CBS Products
Required fields are marked with *
My Review for All CBS Products
Required fields are marked with *
0
Inquiry Basket