Recombinant Mouse Ccl5 protein

Cat.No. : Ccl5-616M
Product Overview : Recombinant Mouse Ccl5 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 68
Description : Chemokine (C-C motif) ligand 5 (CCL5) also known as RANTES is classified as a chemotactic cytokine or chemokine. It is encoded by the CCL5 gene in humans. CCL5 is chemotactic for T cells, eosinophils, and basophils, and plays an active role in recruiting leukocytes into inflammatory sites which has been reported to be produced by renal tubular epithelium, synovial fibroblasts and selected tumor cells. In addition, it also induces the proliferation and activation of certain natural-killer cells to form CHAK cells. Recombinant murine CCL5, a single non-glycosylated polypeptide, contains 68 amino acids and it shares 84 % and 100 % a.a. sequence identity with human and rat CCL5.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 30 % Acetonitrile and 0.1 % TFA.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human T lymphocytes is in a concentration range of 1.0-10 ng/ml.
Molecular Mass : Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 68 amino acids.
AA Sequence : SPYGSDTTPCCFAYLSLALPRAHVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS
Endotoxin : Less than 1 EU/µg of rMuRANTES/CCL5 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name Ccl5
Official Symbol Ccl5
Synonyms CCL5; chemokine (C-C motif) ligand 5; C-C motif chemokine 5; SIS-delta; small inducible cytokine A5; small-inducible cytokine A5; T-cell-specific protein RANTES; SISd; Scya5; RANTES; TCP228; MuRantes;
Gene ID 20304
mRNA Refseq NM_013653
Protein Refseq NP_038681
UniProt ID P30882

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ccl5 Products

Required fields are marked with *

My Review for All Ccl5 Products

Required fields are marked with *

0
cart-icon