Recombinant Mouse Ccl8 protein

• Cat.No.: Ccl8-100M
• Product Overview: Recombinant Mouse Ccl8 protein was expressed in Escherichia coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 74
• Description: Murine CCL8, also known as monocyte chemotactic protein 2 (MCP-2), is belonging to the CC chemokine family and is encoded by the gene CCL8 in mouse. MCP-2 has two homogeneous MCP-1 (CCL2) and MCP-3 (CCL7). These three MCPs were found by IL-1-beta triggered human MG-63 osteosarcoma cells. CCL8 shares 62 % amino acid sequence identity with MCP-1, and shares 58 % amino acid sequence identity with MCP-2. CCL8 has chemotactic fuction for monocytes, eosinophils and neutrophils. In addition, it can also chemoattract activated NK cells.
• Form: Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
• Bio-activity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 10-100 ng/ml.
• Molecular Mass: Approximately 8.5 kDa, a single, non-glycosylated polypeptide chain containing 74 amino acids.
• AA Sequence: GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
• Endotoxin: Less than 1 EU/μg of rMuMCP-2/CCL8 as determined by LAL method.
• Purity: >97% by SDS-PAGE and HPLC analysis.
• Storage: Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.

Gene Information

• Gene Name: Ccl8
• Official Symbol: Ccl8
• Synonyms: CCL8; chemokine (C-C motif) ligand 8; C-C motif chemokine 8; small inducible cytokine A8; small-inducible cytokine A8; monocyte chemotactic protein 2; monocyte chemoattractant protein 2; monocyte chemoattractant protein-2; HC14; Mcp2; MCP-2; Scya8; AB023418; 1810063B20Rik
• Gene ID: 20307
• mRNA Refseq: NM_021443
• Protein Refseq: NP_067418
• UniProt ID: Q9Z121