| Species : | Mouse | 
                                
                                    | Source : | E.coli | 
                                
                                    | Tag : | Non | 
                                
                                    | Protein Length : | 74 | 
                                
                                    | Description : | Murine CCL8, also known as monocyte chemotactic protein 2 (MCP-2), is belonging to the CC chemokine family and is encoded by the gene CCL8 in mouse. MCP-2 has two homogeneous MCP-1 (CCL2) and MCP-3 (CCL7). These three MCPs were found by IL-1-beta triggered human MG-63 osteosarcoma cells. CCL8 shares 62 % amino acid sequence identity with MCP-1, and shares 58 % amino acid sequence identity with MCP-2. CCL8 has chemotactic fuction for monocytes, eosinophils and neutrophils. In addition, it can also chemoattract activated NK cells. | 
                                
                                    | Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl. | 
                                
                                    | Bio-activity  : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 10-100 ng/ml. | 
                                
                                    | Molecular Mass : | Approximately 8.5 kDa, a single, non-glycosylated polypeptide chain containing 74 amino acids. | 
                                
                                    | AA Sequence : | GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP | 
                                
                                    | Endotoxin : | Less than 1 EU/μg of rMuMCP-2/CCL8 as determined by LAL method. | 
                                
                                    | Purity : | >97% by SDS-PAGE and HPLC analysis. | 
                                
                                    | Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. | 
                                
                                    | Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |