Recombinant Mouse Ccl8 protein
Cat.No. : | Ccl8-100M |
Product Overview : | Recombinant Mouse Ccl8 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 74 |
Description : | Murine CCL8, also known as monocyte chemotactic protein 2 (MCP-2), is belonging to the CC chemokine family and is encoded by the gene CCL8 in mouse. MCP-2 has two homogeneous MCP-1 (CCL2) and MCP-3 (CCL7). These three MCPs were found by IL-1-beta triggered human MG-63 osteosarcoma cells. CCL8 shares 62 % amino acid sequence identity with MCP-1, and shares 58 % amino acid sequence identity with MCP-2. CCL8 has chemotactic fuction for monocytes, eosinophils and neutrophils. In addition, it can also chemoattract activated NK cells. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl. |
Bio-activity : | Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood monocytes is in a concentration range of 10-100 ng/ml. |
Molecular Mass : | Approximately 8.5 kDa, a single, non-glycosylated polypeptide chain containing 74 amino acids. |
AA Sequence : | GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP |
Endotoxin : | Less than 1 EU/μg of rMuMCP-2/CCL8 as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Ccl8 |
Official Symbol | Ccl8 |
Synonyms | CCL8; chemokine (C-C motif) ligand 8; C-C motif chemokine 8; small inducible cytokine A8; small-inducible cytokine A8; monocyte chemotactic protein 2; monocyte chemoattractant protein 2; monocyte chemoattractant protein-2; HC14; Mcp2; MCP-2; Scya8; AB023418; 1810063B20Rik; |
Gene ID | 20307 |
mRNA Refseq | NM_021443 |
Protein Refseq | NP_067418 |
UniProt ID | Q9Z121 |
◆ Recombinant Proteins | ||
Ccl8-5744M | Recombinant Mouse Ccl8 Protein (Glu20-Pro97), C-His tagged | +Inquiry |
CCL8-695P | Recombinant Pig CCL8 protein, His & GST-tagged | +Inquiry |
CCL8-302H | Active Recombinant Human Chemokine (C-C Motif) Ligand 8, HIgG1 Fc-tagged, mutant | +Inquiry |
CCL8-45H | Recombinant Human CCL8 Protein | +Inquiry |
CCL8-1290H | Recombinant Human CCL8 Protein (Ser29-Pro99), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ccl8 Products
Required fields are marked with *
My Review for All Ccl8 Products
Required fields are marked with *
0
Inquiry Basket