Recombinant Mouse Cct2 protein
Cat.No. : | Cct2-5284M |
Product Overview : | Recombinant Mouse Cct2 protein(P80314)(2-535 aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 2-535 aa |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | ASLSLAPVNIFKAGADEERAETARLSSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAAL MVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKKI HPQTIISGWREATKAAREALLSSAVDHGSDEARFWQDLMNIAGTTLSSKLLTHHKDHFTK LAVEAVLRLKGSGNLEAIHVIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIAN TGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYPE QLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLIH FSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDPRTVYGGGCSEMLMAHAV TQLANRTPGKEAVAMESFAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGHITAGLDMK EGTIGDMAVLGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Cct2 chaperonin containing Tcp1, subunit 2 (beta) [ Mus musculus ] |
Official Symbol | Cct2 |
Synonyms | CCT2; chaperonin containing Tcp1, subunit 2 (beta); T-complex protein 1 subunit beta; CCT-beta; TCP-1-beta; chaperonin subunit 2 (beta); Cctb; |
Gene ID | 12461 |
mRNA Refseq | NM_007636 |
Protein Refseq | NP_031662 |
◆ Recombinant Proteins | ||
CCT2-1426M | Recombinant Mouse CCT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cct2-5287M | Recombinant Mouse Cct2 protein | +Inquiry |
CCT2-27951TH | Recombinant Human CCT2, His-tagged | +Inquiry |
CCT2-713R | Recombinant Rhesus monkey CCT2 Protein, His-tagged | +Inquiry |
CCT2-382C | Recombinant Cynomolgus CCT2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCT2-7691HCL | Recombinant Human CCT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cct2 Products
Required fields are marked with *
My Review for All Cct2 Products
Required fields are marked with *