Recombinant Mouse Cct3 protein, Avi-tagged, Biotinylated
| Cat.No. : | Cct3-5290M | 
| Product Overview : | Biotinylated Recombinant Mouse Cct3 protein(P80318)(1-545 aa), fused with Avi tag, was expressed in E.coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse | 
| Source : | E.coli | 
| Tag : | Avi | 
| Protein Length : | 1-545 aa | 
| Conjugation/Label : | Biotin | 
| Form : | Tris/PBS-based buffer, 6% Trehalose. | 
| AASequence : | MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMT NDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPT VVISAYRMALDDMISTLKKISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAV KTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVL LDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLA QHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYF TFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAH ALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETWGV NGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQNRQTGAP DAGQE | 
| Purity : | >85% (SDS-PAGE) | 
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. | 
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. | 
| Conjugation : | Biotin | 
| Gene Name | Cct3 chaperonin containing Tcp1, subunit 3 (gamma) [ Mus musculus ] | 
| Official Symbol | Cct3 | 
| Synonyms | CCT3; chaperonin containing Tcp1, subunit 3 (gamma); T-complex protein 1 subunit gamma; mTRiC-P5; matricin; CCT-gamma; TCP-1-gamma; chaperonin subunit 3 (gamma); Cctg; TriC-P5; AL024092; Tcp1-rs3; | 
| Gene ID | 12462 | 
| mRNA Refseq | NM_001243065 | 
| Protein Refseq | NP_001229994 | 
| ◆ Recombinant Proteins | ||
| CCT3-528H | Recombinant Human CCT3 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| CCT3-1232R | Recombinant Rat CCT3 Protein | +Inquiry | 
| CCT3-3041HF | Recombinant Full Length Human CCT3 Protein, GST-tagged | +Inquiry | 
| CCT3-467H | Recombinant Human CCT3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| CCT3-0711H | Recombinant Human CCT3 Protein, GST-Tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CCT3-7690HCL | Recombinant Human CCT3 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cct3 Products
Required fields are marked with *
My Review for All Cct3 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            