Recombinant Mouse Cct3 protein, Avi-tagged, Biotinylated
| Cat.No. : | Cct3-5290M |
| Product Overview : | Biotinylated Recombinant Mouse Cct3 protein(P80318)(1-545 aa), fused with Avi tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Avi |
| Protein Length : | 1-545 aa |
| Conjugation/Label : | Biotin |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMT NDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPT VVISAYRMALDDMISTLKKISTPVDVNNREMMLSIINSSITTKVISRWSSLACNIALDAV KTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVL LDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCEDIIQLKPDVVITEKGISDLA QHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYF TFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAH ALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQESCETWGV NGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQNRQTGAP DAGQE |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Conjugation : | Biotin |
| Gene Name | Cct3 chaperonin containing Tcp1, subunit 3 (gamma) [ Mus musculus ] |
| Official Symbol | Cct3 |
| Synonyms | CCT3; chaperonin containing Tcp1, subunit 3 (gamma); T-complex protein 1 subunit gamma; mTRiC-P5; matricin; CCT-gamma; TCP-1-gamma; chaperonin subunit 3 (gamma); Cctg; TriC-P5; AL024092; Tcp1-rs3; |
| Gene ID | 12462 |
| mRNA Refseq | NM_001243065 |
| Protein Refseq | NP_001229994 |
| ◆ Recombinant Proteins | ||
| CCT3-528H | Recombinant Human CCT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Cct3-5290M | Recombinant Mouse Cct3 protein, Avi-tagged, Biotinylated | +Inquiry |
| CCT3-3041HF | Recombinant Full Length Human CCT3 Protein, GST-tagged | +Inquiry |
| CCT3-2127HFL | Recombinant Full Length Human CCT3 Protein, C-Flag-tagged | +Inquiry |
| Cct3-5288M | Recombinant Mouse Cct3 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCT3-7690HCL | Recombinant Human CCT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cct3 Products
Required fields are marked with *
My Review for All Cct3 Products
Required fields are marked with *
