Recombinant Mouse CD276 Protein, Fc-tagged
Cat.No. : | CD276-602M |
Product Overview : | Recombinant Mouse CD276 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 316 |
Description : | Enables identical protein binding activity and signaling receptor binding activity. Acts upstream of or within several processes, including positive regulation of osteoblast differentiation; regulation of T cell proliferation; and regulation of cytokine production. Located in external side of plasma membrane. Is expressed in several structures, including embryo endoderm; genitourinary system; hemolymphoid system; liver; and musculoskeletal system. Orthologous to human CD276 (CD276 molecule). |
Form : | Lyophilized |
Molecular Mass : | 50.1 kDa |
AA Sequence : | MLRGWGGPSVGVCVRTALGVLCLCLTGAVEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFPPEALWVTVGLSVCLVVLLVALAFVCWRKIKQSCEEENAGAEDQDGDGEGSKTALRPLKPSENKEDDGQEIA |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Cd276 CD276 antigen [ Mus musculus (house mouse) ] |
Official Symbol | CD276 |
Synonyms | CD276; CD276 antigen; B7-H3; B7 homolog 3; costimulatory molecule; B7h3; B7RP-2; AU016588; 6030411F23Rik; |
Gene ID | 102657 |
mRNA Refseq | NM_133983 |
Protein Refseq | NP_598744 |
UniProt ID | Q8VE98 |
◆ Recombinant Proteins | ||
CD276-756H | Active Recombinant Human CD276 Protein, Fc Chimera | +Inquiry |
CD276-1287MAF555 | Recombinant Mouse Cd276 Protein, hFc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
Cd276-41RAF488 | Recombinant Rat Cd276 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CD276-600H | Recombinant Human CD276 Protein, Fc-tagged | +Inquiry |
Cd276-41RAF647 | Recombinant Rat Cd276 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
◆ Native Proteins | ||
CD276-57H | Active Recombinant Human CD276 Protein, His&Avi tagged | +Inquiry |
CD276-56H | Active Recombinant Human CD276 Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD276-1959HCL | Recombinant Human CD276 cell lysate | +Inquiry |
CD276-001MCL | Recombinant Mouse CD276 cell lysate | +Inquiry |
CD276-826RCL | Recombinant Rat CD276 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD276 Products
Required fields are marked with *
My Review for All CD276 Products
Required fields are marked with *
0
Inquiry Basket