Recombinant Mouse Cd47 protein, Fc-tagged

Cat.No. : CD47-3095M
Product Overview : Recombinant Mouse Cd47(Gln19-Pro158) fused with Fc tag at C-terminal was expressed in HEK293.
Availability February 05, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : Fc
Protein Length : Gln19-Pro158
Description : CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
Form : Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
AA Sequence : QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTS AKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKG GCKLVSWFSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKE
Endotoxin : Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Quality Control Test : Has a calculated MW of 40.5 kDa. the reducing (R) protein migrates as 50-66 kDa, and the non-reducing (NR) protein migrates as 100-130 kDa in SDS-PAGE.
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name Cd47 CD47 antigen (Rh-related antigen, integrin-associated signal transducer) [ Mus musculus ]
Official Symbol Cd47
Synonyms CD47; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); leukocyte surface antigen CD47; Rh-related antigen; integrin-associated protein; IAP; Itgp; AA407862; AI848868; AW108519; 9130415E20Rik; B430305P08Rik;
Gene ID 16423
mRNA Refseq NM_010581
Protein Refseq NP_034711
UniProt ID Q61735
Chromosome Location 16; 16 B5
Pathway Cell surface interactions at the vascular wall, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Hemostasis, organism-specific biosystem; Signal regulatory protein (SIRP) family interactions, organism-specific biosystem;
Function protein binding; thrombospondin receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cd47 Products

Required fields are marked with *

My Review for All Cd47 Products

Required fields are marked with *

0
cart-icon
0
compare icon