Recombinant Mouse Cd47 protein, Fc-tagged
Cat.No. : | CD47-3095M |
Product Overview : | Recombinant Mouse Cd47(Gln19-Pro158) fused with Fc tag at C-terminal was expressed in HEK293. |
Availability | August 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | Gln19-Pro158 |
Description : | CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes. |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
AA Sequence : | QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTS AKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTAFNTDQGSACSYEEEKG GCKLVSWFSPVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKE |
Endotoxin : | Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Quality Control Test : | Has a calculated MW of 40.5 kDa. the reducing (R) protein migrates as 50-66 kDa, and the non-reducing (NR) protein migrates as 100-130 kDa in SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | Cd47 CD47 antigen (Rh-related antigen, integrin-associated signal transducer) [ Mus musculus ] |
Official Symbol | Cd47 |
Synonyms | CD47; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); leukocyte surface antigen CD47; Rh-related antigen; integrin-associated protein; IAP; Itgp; AA407862; AI848868; AW108519; 9130415E20Rik; B430305P08Rik; |
Gene ID | 16423 |
mRNA Refseq | NM_010581 |
Protein Refseq | NP_034711 |
UniProt ID | Q61735 |
Chromosome Location | 16; 16 B5 |
Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; ECM-receptor interaction, organism-specific biosystem; ECM-receptor interaction, conserved biosystem; Hemostasis, organism-specific biosystem; Signal regulatory protein (SIRP) family interactions, organism-specific biosystem; |
Function | protein binding; thrombospondin receptor activity; |
◆ Recombinant Proteins | ||
CD47-527H | Recombinant Human CD47 protein, hFc-tagged | +Inquiry |
CD47-913R | Recombinant Rat CD47 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD47-2153H | Recombinant Human CD47 Protein, His-tagged | +Inquiry |
Cd47-647MAF488 | Recombinant Mouse Cd47 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CD47-1B | Recombinant Bovine CD47 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD47-850HCL | Recombinant Human CD47 cell lysate | +Inquiry |
CD47-1363RCL | Recombinant Rat CD47 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd47 Products
Required fields are marked with *
My Review for All Cd47 Products
Required fields are marked with *